Property Summary

NCBI Gene PubMed Count 14
PubMed Score 55.31
PubTator Score 25.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.700 4.2e-05
astrocytoma -1.600 1.6e-18
Astrocytoma, Pilocytic -1.200 1.1e-04
atypical teratoid / rhabdoid tumor -1.600 6.3e-07
ependymoma -1.100 2.3e-02
glioblastoma -1.800 4.0e-09
group 3 medulloblastoma -2.500 1.2e-05
medulloblastoma, large-cell -2.000 5.9e-07
oligodendroglioma -1.600 1.5e-15
Pick disease -1.100 4.6e-02
subependymal giant cell astrocytoma -2.620 5.9e-03

Protein-protein Interaction (1)

Gene RIF (9)

AA Sequence

MKDRTQELRSAKDSDDEEEVVHVDRDHFMDEFFEQVEEIRGCIEKLSEDVEQVKKQHSAILAAPNPDEKT      1 - 70
KQELEDLTADIKKTANKVRSKLKAIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMTEYNATQSKY     71 - 140
RDRCKDRIQRQLEITGRTTTNEELEDMLESGKLAIFTDDIKMDSQMTKQALNEIETRHNEIIKLETSIRE    141 - 210
LHDMFVDMAMLVESQGEMIDRIEYNVEHSVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVVLGVVLAS    211 - 280
SIGGTLGL                                                                  281 - 288
//

Text Mined References (16)

PMID Year Title