Property Summary

NCBI Gene PubMed Count 141
PubMed Score 730.21
PubTator Score 324.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytoma -2.200 4.5e-29
posterior fossa group B ependymoma -3.100 3.6e-15
oligodendroglioma -2.300 8.0e-23
glioblastoma -2.700 6.1e-07
medulloblastoma -1.900 2.8e-05
atypical teratoid / rhabdoid tumor -3.300 2.0e-13
medulloblastoma, large-cell -2.100 1.4e-04
primitive neuroectodermal tumor -2.500 1.1e-05
intraductal papillary-mucinous neoplasm ... 1.300 7.0e-03
active ulcerative colitis 1.023 2.2e-02
breast carcinoma 1.400 1.7e-06
pediatric high grade glioma -2.300 2.8e-06
pilocytic astrocytoma -3.100 8.1e-10
lung adenocarcinoma 2.400 4.1e-09
lung carcinoma 1.100 1.2e-31
Pick disease -1.500 6.9e-03

Gene RIF (60)

PMID Text
26918652 Mislocalization of syntaxin-1 was found in pluripotent stem cells from epileptic encephalopathy patient.
25803850 Blockade of the SNARE protein syntaxin 1 inhibits glioblastoma tumor growth.
25445064 SNARE complex genes and their interactions may play a significant role in susceptibility and working memory of ADHD.
24429282 PIP2 affects islet beta-cell KATP channels not only by its actions on Kir6.2 but also by sequestering Syn-1A to modulate Syn-1A availability and its interactions with SUR1 on PM.
24375629 We described clinical, genetic, and functional data from 17 families with a diagnosis of benign familial neonatal epilepsy caused by KCNQ2 or KCNQ3 mutations and we showed that some mutations lead to a reduction of Q2 channel regulation by syntaxin-1A.
24218570 Prefusion structure of syntaxin-1A suggests pathway for folding into neuronal trans-SNARE complex fusion intermediate.
24164654 no associaton with idiopathic generalized epilepsy was found regarding Intron 7 rs1569061 of Syntaxin 1A gene, MnlI rs3746544 and DdeI rs1051312 polymorphisms of SNAP-25 gene compared with healthy subjects
23858467 N-peptide and LE mutation have no effect on the global conformation of the Munc18a-Syx1a complex.
23801330 the preferential binding of CAPS1 to open syntaxin-1 can contribute to the stabilization of the open state of syntaxin-1 during its transition from "closed" state to the SNARE complex formation.
23572023 The clinical relevance of STX1A variants in CF
23403573 syntaxin 1 and SNAP-25 cooperate as SNARE proteins to support neuron survival.
23242284 In dementia with Lewy bodies patients there were lower levels of syntaxin in visual cortex compared to controls.
22791290 Platelets deficient in Munc18b from a Familial Hemophagocytic Lymphohistiocytosis type 5 had secretion defect.
22571925 The histone modification marks were significantly increased in bipolar disorder and major depression and this effect was correlated with significant increases in Syn1a gene expression.
22411134 Direct interaction between syntaxin 1A and the Kv2.1 C-terminus is required for efficient insulin exocytosis and glucose-stimulated insulin secretion.
22404429 Nesca directly binds KIF5B, kinesin light-chain and syntaxin-1
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22264512 DrrA activation of the Rab1 GTPase on plasma membrane-derived organelles stimulated the tethering of endoplasmic reticulum-derived vesicles, resulting in vesicle fusion through the pairing of Sec22b with the plasma membrane syntaxin proteins.
22250207 Our results provide support for the hypothesis that STX1A represents a susceptibility gene for migraine
22130660 A Ca(v)3.2/syntaxin-1A signaling complex controls T-type channel activity and low-threshold exocytosis.
21976501 Syntaxin 1A effects may be additive but can be blocked at different concentration ranges of calmodulin, suggesting selective presynaptic targeting to directly regulate exocytosis.
21916482 Forming an acceptor SNARE complex between syntaxin-1A and SNAP-25 weakens but does not abrogate cholesterol-controlled cluster formation and indicates that the reconstitution process results in equal incorporation of protein at either lipid composition.
21789195 Recombinant alpha-SNAP-M105I has greater affinity for the cytosolic portion of immunoprecipitated syntaxin than the wild type protein.
21669024 Exocytotic dysfunctions in schizophrenia are probably related to an imbalance of the interaction between munc18-1a and SNARE (mainly syntaxin-1A) complex.
21173146 ATP regulates pancreatic beta-cell K(ATP) channel activity, not only by its direct actions on Kir6.2 pore subunit, but also via ATP modulation of Syn-1A binding to SUR1.
21118708 association of STX1A with autism in a trio association study; in the anterior cingulate gyrus region, STX1A expression in the autism group was found to be significantly lower than controls; suggests a possible role of STX1A in pathogenesis of autism
20564318 Results suggest that variants in RNASEL contribute to susceptibility to early onset and familial forms of prostate cancer.
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20422020 syntaxin 1A, a neuronal regulator of presynaptic vesicle release, may play a role in WS and be a component of the cellular pathway determining human intelligence.
20385907 We confirmed the involvement of syntaxin 1A in migraine susceptibility regarding rs941298. In addition, we found rs6951030 to also be associated in Portuguese migraine patients.
20385907 Observational study of gene-disease association. (HuGE Navigator)
19578796 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19557857 Observational study of gene-disease association. (HuGE Navigator)
19368856 This analysis revealed significant differences in both allele frequencies and genotype distributions of the STX1A gene in migraine.
19368856 Observational study of gene-disease association. (HuGE Navigator)
19129200 Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.(
19004828 Direct interaction of otoferlin with syntaxin 1A, SNAP-25, and the L-type voltage-gated calcium channel Cav1.3.
18593506 STX1A might influence the serotonergic system during neurodevelopment
18593506 Observational study of gene-disease association. (HuGE Navigator)
18512733 SNARE complex-related genes STX1A, VAMP2 and SNAP25 do not play a major role in susceptibility to schizophrenia in the Japanese population
18512733 Observational study of gene-disease association. (HuGE Navigator)
18457912 The expression of the SNARE protein SNAP-25 and its cellular homologue SNAP-23, as well as syntaxin1 and VAMP (vesicle-associated membrane protein) in samples of normal parathyroid tissue, chief cell adenoma, and parathyroid carcinoma, was examined.
18065728 We have identified a new three-gene classifier that is independent of and improves on stage to stratify early-stage NSCLC patients with significantly different prognoses.
17912268 A lower frequency of the PRM -352T allele of the STX1A gene in overweight/obese subjects impaires glucose regulation, particularly among individuals with combined glucose intolerance and overt diabetes.
17912268 Observational study of gene-disease association. (HuGE Navigator)
17543282 the H(abc) domain has a role in membrane trafficking and targeting of syntaxin 1A
17506992 the mechanisms involved in Syn1A-K(v) interactions vary significantly between K(v) channels, thus providing a wide scope for Syn1A modulation of exocytosis and membrane excitability
17264080 analysis of the spatially distinct modes of munc18-syntaxin 1 interaction
17032905 Norepinephrine transpossrter/syntaxin 1A complex rapidly redistributes, upon amphetamine treatment, when mechanisms supported by the transporter's NH2 terminus are eliminated.
16672225 Syntaxin-1A actions on sulfonylurea receptor 2A blocks acidic pH-induced cardiac K(ATP) channel activation
15339904 Syn-1A binds both NBFs of SUR1 and SUR2A but appears to exhibit distinct interactions with NBF2 of these SUR proteins in modulating the KATP channels in islet beta cells and cardiac myocytes
15316009 cleavage of APP but not syntaxin 1 is independent of cell surface regulation by extracellular ligands
15219469 A significant genetic association was found between schizophrenia and an intron 7 single nucleotide polymorphism (SNP) tested. Haplotype analysis supported the association with several significant values that appear to be driven by the intron 7 SNP.
15202772 interacts with dopamine transporter
15175344 Syntaxin/Munc18 interactions in the late events during vesicle fusion and release in exocytosis
12446681 interacts with CFTR protein differently from interactions with SNARE.
12209004 CFTR channels are coordinately regulated by two cognate t-SNAREs, SNAP-23 (synaptosome-associated protein of 23 kDa) and syntaxin 1A.
12198139 Munc18b binds to syntaxins 1A, 2, and 3 and regulates vesicle transport to the apical plasma membrane
12114505 SNAP-25 traffics to the plasma membrane by a syntaxin-independent mechanism.
11719842 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MKDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENVEEVKRKHSAILASPNPDEK      1 - 70
TKEELEELMSDIKKTANKVRSKLKSIEQSIEQEEGLNRSSADLRIRKTQHSTLSRKFVEVMSEYNATQSD     71 - 140
YRERCKGRIQRQLEITGRTTTSEELEDMLESGNPAIFASGIIMDSSISKQALSEIETRHSEIIKLENSIR    141 - 210
ELHDMFMDMAMLVESQGEMIDRIEYNVEHAVDYVERAVSDTKKAVKYQSKARRKKIMIIICCVILGIVIA    211 - 280
STVGGIFA                                                                  281 - 288
//

Text Mined References (143)

PMID Year Title
26918652 2016 Mislocalization of syntaxin-1 and impaired neurite growth observed in a human iPSC model for STXBP1-related epileptic encephalopathy.
26359495 2015 The Q-soluble N-Ethylmaleimide-sensitive Factor Attachment Protein Receptor (Q-SNARE) SNAP-47 Regulates Trafficking of Selected Vesicle-associated Membrane Proteins (VAMPs).
25803850 2015 Blockade of the SNARE protein syntaxin 1 inhibits glioblastoma tumor growth.
25445064 2015 Synaptosome-related (SNARE) genes and their interactions contribute to the susceptibility and working memory of attention-deficit/hyperactivity disorder in males.
24885604 2014 CFTR and Anoctamin 1 (ANO1) contribute to cAMP amplified exocytosis and insulin secretion in human and murine pancreatic beta-cells.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24429282 2014 Phosphatidylinositol 4,5-biphosphate (PIP2) modulates interaction of syntaxin-1A with sulfonylurea receptor 1 to regulate pancreatic ?-cell ATP-sensitive potassium channels.
24375629 2014 Novel KCNQ2 and KCNQ3 mutations in a large cohort of families with benign neonatal epilepsy: first evidence for an altered channel regulation by syntaxin-1A.
24218570 2013 Prefusion structure of syntaxin-1A suggests pathway for folding into neuronal trans-SNARE complex fusion intermediate.
24164654 2014 Genetic variants of synaptic vesicle and presynaptic plasma membrane proteins in idiopathic generalized epilepsy.
23858467 2013 Syntaxin1a variants lacking an N-peptide or bearing the LE mutation bind to Munc18a in a closed conformation.
23801330 2013 Calcium-dependent activator protein for secretion 1 (CAPS1) binds to syntaxin-1 in a distinct mode from Munc13-1.
23572023 2013 Clinical and molecular characterization of the potential CF disease modifier syntaxin 1A.
23403573 2013 Cytotoxicity of botulinum neurotoxins reveals a direct role of syntaxin 1 and SNAP-25 in neuron survival.
23242284 2013 Synaptic proteins and choline acetyltransferase loss in visual cortex in dementia with Lewy bodies.
22791290 2012 Munc18b/STXBP2 is required for platelet secretion.
22571925 2013 H3K4 tri-methylation in synapsin genes leads to different expression patterns in bipolar disorder and major depression.
22411134 2012 The voltage-dependent potassium channel subunit Kv2.1 regulates insulin secretion from rodent and human islets independently of its electrical function.
22404429 2012 Nesca, a novel neuronal adapter protein, links the molecular motor kinesin with the pre-synaptic membrane protein, syntaxin-1, in hippocampal neurons.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22264512 2012 The Legionella pneumophila effector DrrA is sufficient to stimulate SNARE-dependent membrane fusion.
22250207 2012 Association analysis of STX1A gene variants in common forms of migraine.
22130660 2012 A Ca(v)3.2/syntaxin-1A signaling complex controls T-type channel activity and low-threshold exocytosis.
21976501 2011 Regulation of neuronal M-channel gating in an isoform-specific manner: functional interplay between calmodulin and syntaxin 1A.
21916482 2011 Molecular mechanism of cholesterol- and polyphosphoinositide-mediated syntaxin clustering.
21789195 2011 ?-SNAP prevents docking of the acrosome during sperm exocytosis because it sequesters monomeric syntaxin.
21669024 2012 Regulation of munc18-1 and syntaxin-1A interactive partners in schizophrenia prefrontal cortex: down-regulation of munc18-1a isoform and 75 kDa SNARE complex after antipsychotic treatment.
21173146 2011 ATP modulates interaction of syntaxin-1A with sulfonylurea receptor 1 to regulate pancreatic beta-cell KATP channels.
21118708 2011 Replication study of Japanese cohorts supports the role of STX1A in autism susceptibility.
20564318 2010 Contribution of HPC1 (RNASEL) and HPCX variants to prostate cancer in a founder population.
20471030 2010 Proteome analysis of the thalamus and cerebrospinal fluid reveals glycolysis dysfunction and potential biomarkers candidates for schizophrenia.
20422020 2010 Intelligence in Williams Syndrome is related to STX1A, which encodes a component of the presynaptic SNARE complex.
20385907 2010 Evidence of syntaxin 1A involvement in migraine susceptibility: a Portuguese study.
19748891 2010 Munc18/Syntaxin interaction kinetics control secretory vesicle dynamics.
19578796 2009 Association of genetic variants with chronic kidney disease in individuals with different lipid profiles.
19557857 2009 De novo STXBP1 mutations in mental retardation and nonsyndromic epilepsy.
19546860 2010 The dysbindin-containing complex (BLOC-1) in brain: developmental regulation, interaction with SNARE proteins and role in neurite outgrowth.
19368856 2009 Contribution of syntaxin 1A to the genetic susceptibility to migraine: a case-control association study in the Spanish population.
19129200 2009 Homology with vesicle fusion mediator syntaxin-1a predicts determinants of epimorphin/syntaxin-2 function in mammary epithelial morphogenesis.
19004828 2009 Direct interaction of otoferlin with syntaxin 1A, SNAP-25, and the L-type voltage-gated calcium channel Cav1.3.
18617632 2008 Syntaxin 1A interaction with the dopamine transporter promotes amphetamine-induced dopamine efflux.
18593506 2008 Genetic and expression analyses reveal elevated expression of syntaxin 1A ( STX1A) in high functioning autism.
18570918 2008 Endosomal SNARE proteins regulate CFTR activity and trafficking in epithelial cells.
18512733 2008 No association between tagging SNPs of SNARE complex genes (STX1A, VAMP2 and SNAP25) and schizophrenia in a Japanese population.
18457912 2008 Heterogeneous expression of SNARE proteins SNAP-23, SNAP-25, Syntaxin1 and VAMP in human parathyroid tissue.
18065728 2007 Three-gene prognostic classifier for early-stage non small-cell lung cancer.
17912268 2008 Search for genetic variants of the SYNTAXIN 1A (STX1A) gene: the -352 A>T variant in the STX1A promoter associates with impaired glucose metabolism in an Italian obese population.
17543282 2007 Role of H(abc) domain in membrane trafficking and targeting of syntaxin 1A.
17506992 2007 Modulation of the K(v)4.3 channel by syntaxin 1A.
17264080 2007 Functionally and spatially distinct modes of munc18-syntaxin 1 interaction.
17200691 2006 Distinct domain-dependent effect of syntaxin1A on amiloride-sensitive sodium channel (ENaC) currents in HT-29 colonic epithelial cells.
17032905 2007 Amphetamine induces a calcium/calmodulin-dependent protein kinase II-dependent reduction in norepinephrine transporter surface expression linked to changes in syntaxin 1A/transporter complexes.
16722236 2006 The role of SNARE proteins in trafficking and function of neurotransmitter transporters.
16672225 2006 Syntaxin-1A actions on sulfonylurea receptor 2A can block acidic pH-induced cardiac K(ATP) channel activation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15822905 Phosphoproteomic analysis of synaptosomes from human cerebral cortex.
15563604 2005 Munc18-1 regulates early and late stages of exocytosis via syntaxin-independent protein interactions.
15537656 2005 A direct interaction between Cdc42 and vesicle-associated membrane protein 2 regulates SNARE-dependent insulin exocytosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15459722 2004 Syntabulin is a microtubule-associated protein implicated in syntaxin transport in neurons.
15339904 2004 Syntaxin-1A inhibits cardiac KATP channels by its actions on nucleotide binding folds 1 and 2 of sulfonylurea receptor 2A.
15316009 2004 Proteolytic processing of amyloid-beta precursor protein by secretases does not require cell surface transport.
15219469 2004 Association between schizophrenia and the syntaxin 1A gene.
15202772 2004 Syntaxin 1A and receptor for activated C kinase interact with the N-terminal region of human dopamine transporter.
15184072 2004 Identification and characterization of taxilin isoforms.
15175344 2004 Syntaxin/Munc18 interactions in the late events during vesicle fusion and release in exocytosis.
14996668 2004 ENaC subunit-subunit interactions and inhibition by syntaxin 1A.
14623309 2003 Identification of mouse Vps16 and biochemical characterization of mammalian class C Vps complex.
12853948 2003 The DNA sequence of human chromosome 7.
12853575 2003 A dual mechanism controlling the localization and function of exocytic v-SNAREs.
12730201 2003 Ca2+-dependent phosphorylation of syntaxin-1A by the death-associated protein (DAP) kinase regulates its interaction with Munc18.
12651853 2003 Syntaxin isoform specificity in the regulation of renal H+-ATPase exocytosis.
12629174 2003 A regulated interaction of syntaxin 1A with the antidepressant-sensitive norepinephrine transporter establishes catecholamine clearance capacity.
12586365 2003 Expression of syntaxin 1C, an alternative splice variant of HPC-1/syntaxin 1A, is enhanced by phorbol-ester stimulation in astroglioma: participation of the PKC signaling pathway.
12562778 2003 Syntaxin 1A regulates ENaC via domain-specific interactions.
12558796 2003 Taxilin; a novel syntaxin-binding protein that is involved in Ca2+-dependent exocytosis in neuroendocrine cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446681 2003 The interaction between syntaxin 1A and cystic fibrosis transmembrane conductance regulator Cl- channels is mechanistically distinct from syntaxin 1A-SNARE interactions.
12403834 2002 Synaptosome-associated protein of 25 kilodaltons modulates Kv2.1 voltage-dependent K(+) channels in neuroendocrine islet beta-cells through an interaction with the channel N terminus.
12209004 2002 CFTR chloride channels are regulated by a SNAP-23/syntaxin 1A complex.
12200427 2002 Action of complexin on SNARE complex.
12198139 2002 Analysis of the Munc18b-syntaxin binding interface. Use of a mutant Munc18b to dissect the functions of syntaxins 2 and 3.
12175857 Role of syntaxin 1A on serotonin transporter expression in developing thalamocortical neurons.
12145319 2002 Amisyn, a novel syntaxin-binding protein that may regulate SNARE complex assembly.
12130530 2002 Vesicle-associated membrane protein 3 (VAMP-3) and VAMP-8 are present in human platelets and are required for granule secretion.
12115694 2002 Cellular localization of the vesicular inhibitory amino acid transporter in the mouse and human retina.
12114505 2002 SNAP-25 traffics to the plasma membrane by a syntaxin-independent mechanism.
12101244 2002 Granuphilin modulates the exocytosis of secretory granules through interaction with syntaxin 1a.
12093152 2002 Munc 18a binding to syntaxin 1A and 1B isoforms defines its localization at the plasma membrane and blocks SNARE assembly in a three-hybrid system assay.
11977160 2002 Refinement of the genomic structure of STX1A and mutation analysis in nondeletion Williams syndrome patients.
11960023 2002 Substrates regulate gamma-aminobutyric acid transporters in a syntaxin 1A-dependent manner.
11884041 2002 SNARE complex assembly is required for human sperm acrosome reaction.
11845306 2001 Role of snare proteins in CFTR and ENaC trafficking.
11719842 2001 Single nucleotide polymorphism (D68D, T to C) in the syntaxin 1A gene correlates to age at onset and insulin requirement in Type II diabetic patients.
11509230 2001 The survival of motor neurons (SMN) protein interacts with the snoRNP proteins fibrillarin and GAR1.
11438523 2001 Peroxisome proliferator-activated receptor-gamma-independent inhibition of macrophage activation by the non-thiazolidinedione agonist L-796,449. Comparison with the effects of 15-deoxy-delta(12,14)-prostaglandin J(2).
11438522 2001 Actin cytoskeletal association of cytohesin-1 is regulated by specific phosphorylation of its carboxyl-terminal polybasic domain.
11112705 2001 Localization of cellubrevin-related peptide, endobrevin, in the early endosome in pancreatic beta cells and its physiological function in exo-endocytosis of secretory granules.
11101518 2000 A SNARE complex mediating fusion of late endosomes defines conserved properties of SNARE structure and function.
11017172 2000 Transport rates of GABA transporters: regulation by the N-terminal domain and syntaxin 1A.
10954418 2000 Membrane localization and biological activity of SNAP-25 cysteine mutants in insulin-secreting cells.
10844023 2000 Phosphorylated syntaxin 1 is localized to discrete domains along a subset of axons.
10746715 2000 Three-dimensional structure of the neuronal-Sec1-syntaxin 1a complex.
10722844 2000 Characterization of the interactions between the glycine transporters GLYT1 and GLYT2 and the SNARE protein syntaxin 1A.
10707983 2000 Syntaphilin: a syntaxin-1 clamp that controls SNARE assembly.
10675364 2000 Syntaxin 1A is expressed in airway epithelial cells, where it modulates CFTR Cl(-) currents.
10644452 1999 Expression analysis and protein localization of the human HPC-1/syntaxin 1A, a gene deleted in Williams syndrome.
10468580 1999 Syntaxin 1 interacts with the L(D) subtype of voltage-gated Ca(2+) channels in pancreatic beta cells.
10449403 1999 A conformational switch in syntaxin during exocytosis: role of munc18.
10409621 1999 Interaction of syntaxins with the amiloride-sensitive epithelial sodium channel.
10397765 1999 Functional and biochemical analysis of the C2 domains of synaptotagmin IV.
10373452 1999 EHSH1/intersectin, a protein that contains EH and SH3 domains and binds to dynamin and SNAP-25. A protein connection between exocytosis and endocytosis?
10321247 1999 The septin CDCrel-1 binds syntaxin and inhibits exocytosis.
10194441 1999 Human platelets contain SNARE proteins and a Sec1p homologue that interacts with syntaxin 4 and is phosphorylated after thrombin activation: implications for platelet secretion.
10100611 1999 A stable interaction between syntaxin 1a and synaptobrevin 2 mediated by their transmembrane domains.
10099709 1999 Genetics of synaptic vesicle function: toward the complete functional anatomy of an organelle.
10080545 1999 Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1.
9930733 1999 Differential phosphorylation of syntaxin and synaptosome-associated protein of 25 kDa (SNAP-25) isoforms.
9852078 1998 Three novel proteins of the syntaxin/SNAP-25 family.
9698305 1998 Protein kinase C regulates the interaction between a GABA transporter and syntaxin 1A.
9697855 1998 The AMPA receptor GluR2 C terminus can mediate a reversible, ATP-dependent interaction with NSF and alpha- and beta-SNAPs.
9620695 1998 Tomosyn: a syntaxin-1-binding protein that forms a novel complex in the neurotransmitter release process.
9556632 1998 Protease resistance of syntaxin.SNAP-25.VAMP complexes. Implications for assembly and structure.
9478941 1998 Regulation of Munc-18/syntaxin 1A interaction by cyclin-dependent kinase 5 in nerve endings.
9395480 1997 Mints, Munc18-interacting proteins in synaptic vesicle exocytosis.
9384384 1997 Regulation of CFTR chloride channels by syntaxin and Munc18 isoforms.
9311751 1997 Hemizygous deletion of the syntaxin 1A gene in individuals with Williams syndrome.
9177791 1997 Mapping of the human HPC-1/syntaxin 1A gene (STX1A) to chromosome 7 band q11.2.
9067339 1997 In vitro characterization of botulinum toxin types A, C and D action on human tissues: combined electrophysiologic, pharmacologic and molecular biologic approaches.
9045631 1997 Characterization of Munc-18c and syntaxin-4 in 3T3-L1 adipocytes. Putative role in insulin-dependent movement of GLUT-4.
9030619 1997 Effect of mutations in vesicle-associated membrane protein (VAMP) on the assembly of multimeric protein complexes.
9010211 1997 Synaptotagmin-syntaxin interaction: the C2 domain as a Ca2+-dependent electrostatic switch.
9003414 1997 Novel isoform of syntaxin 1 is expressed in mammalian cells.
8999968 1997 Direct interaction of the rat unc-13 homologue Munc13-1 with the N terminus of syntaxin.
8611567 1996 Botulinum neurotoxin C1 cleaves both syntaxin and SNAP-25 in intact and permeabilized chromaffin cells: correlation with its blockade of catecholamine release.
8108429 1994 n-Sec1: a neural-specific syntaxin-binding protein.
7791877 1995 Ca(2+)-dependent and -independent activities of neural and non-neural synaptotagmins.
7768895 1995 A novel ubiquitous form of Munc-18 interacts with multiple syntaxins. Use of the yeast two-hybrid system to study interactions between proteins involved in membrane traffic.
7622514 1995 The N-ethylmaleimide-sensitive fusion protein and alpha-SNAP induce a conformational change in syntaxin.
7622072 1995 Cloning and sequence analysis of a cDNA encoding human syntaxin 1A, a polypeptide essential for exocytosis.
7553862 1995 Complexins: cytosolic proteins that regulate SNAP receptor function.
1321498 1992 Syntaxin: a synaptic protein implicated in docking of synaptic vesicles at presynaptic active zones.
1315316 1992 A multisubunit particle implicated in membrane fusion.