Property Summary

NCBI Gene PubMed Count 7
PubMed Score 0.19
PubTator Score 1.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

AA Sequence

MKDRLQELKQRTKEIELSRDSHVSTTETEEQGVFLQQAVIYEREPVAERHLHEIQKLQESINNLADNVQK      1 - 70
FGQQQKSLVASMRRFSLLKRESTITKEIKIQAEYINRSLNDLVKEVKKSEVENGPSSVVTRILKSQHAAM     71 - 140
FRHFQQIMFIYNDTIAAKQEKCKTFILRQLEVAGKEMSEEDVNDMLHQGKWEVFNESLLTEINITKAQLS    141 - 210
EIEQRHKELVNLENQIKDLRDLFIQISLLVEEQGESINNIEMTVNSTKEYVNNTKEKFGLAVKYKKRNPC    211 - 280
RVLCCWCCPCCSSK                                                            281 - 294
//

Text Mined References (7)

PMID Year Title