Property Summary

NCBI Gene PubMed Count 33
PubMed Score 44.96
PubTator Score 44.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
axial spondyloarthropathy 1.100 4.8e-02
COPD -1.100 2.8e-03
cystic fibrosis -1.827 7.6e-06
ductal carcinoma in situ -1.400 1.3e-03
fibroadenoma -1.300 4.1e-02
gastric cancer -1.300 1.4e-02
lung adenocarcinoma -2.100 2.0e-15
lung carcinoma -3.700 1.6e-47
mucosa-associated lymphoid tissue lympho... 1.602 6.6e-03
Multiple Sclerosis 1.600 4.3e-03
non-small cell lung cancer -1.791 9.6e-22
pancreatic cancer -1.200 3.0e-02
pancreatic carcinoma -1.200 3.0e-02

Gene RIF (18)

AA Sequence

MKDRLAELLDLSKQYDQQFPDGDDEFDSPHEDIVFETDHILESLYRDIRDIQDENQLLVADVKRLGKQNA      1 - 70
RFLTSMRRLSSIKRDTNSIAKAIKARGEVIHCKLRAMKELSEAAEAQHGPHSAVARISRAQYNALTLTFQ     71 - 140
RAMHDYNQAEMKQRDNCKIRIQRQLEIMGKEVSGDQIEDMFEQGKWDVFSENLLADVKGARAALNEIESR    141 - 210
HRELLRLESRIRDVHELFLQMAVLVEKQADTLNVIELNVQKTVDYTGQAKAQVRKAVQYEEKNPCRTLCC    211 - 280
FCCPCLK                                                                   281 - 287
//

Text Mined References (34)

PMID Year Title