Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.08
PubTator Score 7.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
tuberculosis 1563 2.2e-09
psoriasis 6685 2.4e-04
Disease Target Count Z-score Confidence
Inclusion body myositis 12 3.524 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 2.4e-04
tuberculosis 1.700 2.2e-09

Gene RIF (2)

PMID Text
26442221 Loss of syntaxin 10 leads to defects in normal chlamydial maturation including: variable inclusion size with fewer chlamydial organisms per inclusion, fewer infectious progeny, and delayed or halted reticulate body-elementary body differentiation.
16154903 May have a hitherto unrecognized function in the trans-Golgi network-endosome boundary.

AA Sequence

MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGI      1 - 70
VEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDAS     71 - 140
AVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMD    141 - 210
GVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL                                   211 - 249
//

Text Mined References (19)

PMID Year Title
26442221 2015 The trans-Golgi SNARE syntaxin 10 is required for optimal development of Chlamydia trachomatis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18195106 2008 A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells.
16341674 2005 Transcriptome analysis of human gastric cancer.
16154903 Trans-Golgi network syntaxin 10 functions distinctly from syntaxins 6 and 16.
15878329 2005 Characterization of the human GARP (Golgi associated retrograde protein) complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10080545 1999 Co-expression of several human syntaxin genes in neutrophils and differentiating HL-60 cells: variant isoforms and detection of syntaxin 1.
9446797 1998 Syntaxin 10: a member of the syntaxin family localized to the trans-Golgi network.