Property Summary

NCBI Gene PubMed Count 180
PubMed Score 813.46
PubTator Score 75.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.200 5.7e-08
medulloblastoma -1.100 1.9e-05
medulloblastoma, large-cell -1.300 2.2e-05
primitive neuroectodermal tumor -1.200 7.2e-05
diabetes mellitus -1.100 2.8e-03
ovarian cancer 2.500 2.4e-08

Protein-protein Interaction (3)

Gene RIF (124)

PMID Text
26900751 CHIP is a bona fide negative regulator of the RIPK1-RIPK3 necrosome formation leading to desensitization of TNF-mediated necroptosis
26658161 Data show that the E3 ubiquitin ligase CHIP interacts with protein arginine methyltransferase-5 (PRMT5) both in vivo and in vitro.
26330542 Protein-protein interactions modulate the docking-dependent E3-ubiquitin ligase activity of CHIP.
26321754 CHIP is required for protein quality control (PQC) and CHIP knockdown diminished cellular PQC capacity in lens cells.
26232501 These results indicate that CHIP decreases the Kv1.5 protein level and functional channel by facilitating its degradation in concert with chaperone Hsc70
26219223 Data suggest that CHIP plays roles in the regulation of autophagic flux.
26206088 Cdk5-mediated phosphorylation of CHIP negatively regulates its neuroprotective function, thereby contributing to neuronal cell death progression following neurotoxic stimuli.
26021863 Our findings demonstrate for the first time that CHIP may be involved in RCC angiogenesis through regulating VEGF secretion and expression of VEGFR2.
26010904 detailed and systematic investigation to characterize if there are significant differences in the CHIP in vitro ubiquitination of human Hsp70 and Hsc70.
25987026 High expression of CHIP is associated with HBV-related Hepatocellular Carcinoma.
25879443 results indicate that the post-endocytic ubiquitination of CFTR by CHIP is a critical step in the peripheral quality control of cell surface DeltaF508 CFTR
25792747 CHIP/TRAF3/NIK interactions recruit NIK to E3 ligase complexes for ubiquitination and degradation, thus maintaining NIK at low levels
25773675 CHIP stabilizes amyloid precursor protein via proteasomal degradation and p53-mediated trans-repression of BACE1.
25684577 CHIP docks onto Hsp70/Hsc70 and defines a bipartite mode of interaction between TPR domains and their binding partners.
25672477 these observations provide functional evidence for CHIP behaviors as a tumor suppressor in gastric cancer.
25635996 miR-1178 acts as an oncomiR in pancreatic cancer cells by inhibiting CHIP expression.
25435366 CHIP masks genetic variations to suppress heterogeneous Bcl-2 expression levels and prevents augmentation of the anticancer drug-resistant population of breast cancer cells.
25258038 Whether the clinical heterogeneity seen in STUB1 ARCA can be related to the location of the mutations remains to be understood
25234599 From our results, we propose that inhibition of CSC properties may be one of the functions of CHIP as a suppressor of cancer progression.
25225294 CHIP-mediated ubiquitination of IRE1 contributes to the dynamic regulation of the unfolded protein response.
24912674 CHIP modulates MLK3 protein levels in response to Geldanamycin and stress stimuli, and CHIP-dependent regulation of MLK3 is required for suppression of SKOV3 ovarian cancer cell invasion.
24722501 These observations indicate that CHIP serves as a novel tumor suppressor by downregulating EGFR pathway in pancreatic cancer cells, decreased expression of CHIP was associated with poor prognosis in pancreatic cancer.
24719489 STUB1 should be added to the constantly growing list of genes in testing panels for the genetic diagnosis of inherited ataxias.
24661873 C-terminus of Hsc70-interacting protein (CHIP), a co-chaperone E3 ligase, interacts with and ubiquitinates Pfn1, targeting it for proteasome-dependent degradation.
24651434 Ebp1 p42 isoform regulates the proteasomal degradation of the p85 regulatory subunit of PI3K by recruiting a chaperone-E3 ligase complex HSP70/CHIP.
24613385 Reveal an opposite role of Hsp70 and Hsp90 in regulating TGF-beta signaling by implicating CHIP-mediated Smad3 ubiquitination and degradation. This study provides a new insight into understanding the regulation of the TGF-beta signaling by chaperones.
24578159 CHIP inhibits NF-kappaB signaling by promoting TRAF6 degradation and plays an important role in osteoclastogenesis and bone remodeling.
24509416 CHIP interacted with eIF5A and mediated its ubiquitination for degradation.
24376685 CHIP-modulated AKT/FoxO/Bim signaling pathway induces apoptosis resistance in breast cancer.
24312598 CHIP as a novel causative gene for autosomal recessive cerebellar ataxia
24302614 CHIP/Stub1 functions as a tumor suppressor and represses NF-kappaB-mediated signaling in colorectal cancer.
24113144 A homozygous mutation in STUB1 associated with Gordon Holmes syndrome.
24043303 CHIP noncanonically ubiquitinates SirT6 at K170, which stabilizes SirT6 and prevents SirT6 canonical ubiquitination by other ubiquitin ligases.
23990462 the U-box mutation stimulated CHIP binding to Hsc70 while promoting CHIP oligomerization. CHIP binding to Hsc70 binding was also stimulated by the presence of an Hsc70 client with a preference for the ADP-bound state.
23973223 stress signals elicited by proinflammatory cytokines and lipopolysaccharides lead to the degradation of Foxp3 through the action of the E3 ubiquitin ligase Stub1.
23963841 Enhancement of HERG protein expression through Hsp90 inhibition of CHIP binding might be a novel therapeutic strategy for long QT syndrome 2 caused by trafficking abnormalities of HERG proteins.
23880665 the ubiquitin ligase STUB1 is required for degradation of HIF1A in the lysosome by chaperone-mediated autophagy.
23865999 CHIP binds tightly to two molecules of Hsc70 forming a 210 kDa complex, with a Kd of approximately 60 nM, and that the IEEVD motif at the C-terminus of Hsc70 (residues 642-646) is both necessary and sufficient for binding.
23764847 CHIP overexpression reduces EndoG levels, and results in reduced or no oxidative stress-induced cell death in cultured cancer cells.
23679257 Single nucleotide polymorphism in the CHIP gene is not associated with intracranial aneurysm.
23410750 these data demonstrate that CHIP regulates the steady-state level of CtBP2 as an E3 ubiquitin ligase and determines the expression levels of CtBP2 target genes.
23344957 Data indicate S100A2 and S100P proteins as novel Ca2+-dependent regulators of the CHIP-proteasome pathway.
23322406 These data provide the first evidence that ubiquitination of CARMA1 by STUB1 promotes TCR-induced NF-kappaB signaling.
23246967 The E3 ligase CHIP modulates cell cycle arrest via proteasomal degradation of ubiquitinated androgen receptor.
22895543 the decreased expression of CHIP was correlated with lymph node metastasis in gastric cancer
22824801 results show phosphorylation of the C-terminal region of Hsp70 and Hsp90 is critical for the decision between folding or degradation of client proteins by altering the binding of CHIP and HOP; also show increased phosphorylation in cancer cells with increased levels of the co-chaperone
22670667 Investigated how heat and urea affect the stability of Carboxyl terminus of Hsp70 interacting protein (CHIP) domains.
22543587 The present study may strengthen the view that CHIP acts as a tumor suppressor.
22492994 evidence that CHIP binds, ubiquitinates and regulates expression of histone deacetylase 6 (HDAC6); demonstrated HDAC6 levels correlate with tau burden, while a decrease in HDAC6 activity or expression promotes tau clearance; evidence that loss of HDAC6 activity augments the efficacy of an Hsp90 inhibitor and drives degradation of tau
22433856 Data show that growth hormone receptor (GHR) endocytosis requires both ubiquitin-conjugating enzyme Ubc13 and the ubiquitin ligase COOH terminus of Hsp70 interacting protein (CHIP).
22427670 Data show that CHIP interacts with PTEN and promotes its proteasomal degradation.
22407479 miR-764-5p positively regulates osteoblast differentiation from osteoblast progenitor cells by repressing the translation of CHIP protein
22190034 HIV-1 Vif is identified to have a physical interaction with STIP1 homology and U-box containing protein 1, E3 ubiquitin protein ligase (STUB1) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22090276 Inhibition of CHIP restored the ability of mutants to mediate normal functions of menin.
22038067 It inhibits cell growth of Hela cells through increasing the G2 phase of cell cycle.
21995445 We demonstrate that CHIP and c-Cbl depletion have no effect on CFTR endocytosis.
21911421 These findings suggest that CHIP facilitates the formation of a TLR4/9 signaling complex by recruiting, ubiquitinating, and activating Src and PKCzeta.
21793045 results suggest that CHIP regulates NF-kappaB-mediated cell invasion via the down-regulation of TRAF2
21710689 our data suggest that Tid1 and CHIP play pivotal roles in affecting the levels of ErbB2 protein, and that both are significant prognostic indicators of breast cancer patient survival.
21454478 CHIP inhibits the signaling activities of Smad1/5 by recruiting Smad1/5 from the functional R-/Co-Smad complex and further promoting the ubiquitination/degradation of Smad1/5 in a chaperone-independent manner.
21358815 A novel function for BAG5 as a modulator of CHIP E3 ubiquitin ligase activity with implications for CHIP-mediated regulation of alpha-syn oligomerization.
21293491 Data indicate that CHIP and USP2 show antagonistic functions in the control of AIF-mediated cell death, and implicate the role of the enzymes as a switch for cells to live or die under stresses that cause truncated AIF release.
21272160 This is the first study demonstrating CHIP contributes to oncogenesis of glioma
21220432 E3 ligase STUB1/CHIP regulates NAD(P)H:quinone oxidoreductase 1 (NQO1) accumulation in aged brain, a process impaired in certain Alzheimer disease patients.
21124777 Data show that increased association of Hsp40/70 with HIF-1alpha led to recruitment of CHIP, which promoted polyubiquitination and degradation of HIF-1alpha.
20959453 CHIP promotes human telomerase reverse transcriptase degradation and negatively regulates telomerase activity
20947504 a complex relationship between CHIP and IRF-1
20924358 Hsp90/SENP3 association protects SENP3 from CHIP-mediated ubiquitination and subsequent degradation, but this effect of Hsp90 requires the presence of CHIP.
20677910 Study provides the first evidence that cortical CHIP expression is increased after ischemic stroke.
20661446 Study observed the strongest interaction between CHIP and the progesterone receptors-Hsp90 heterocomplex, as well as with glucocorticoid receptors.
20618441 CHIP preferentially ubiquitinates Hsp70-bound substrates
20413784 Downregulation of CHIP level by hypoxia was responsible for p53 accumulation in the heart after myocardial infarction. Decreasing the amount of p53 prevented myocardial apoptosis and ameliorated ventricular remodeling after myocardial infarction.
20151404 The involvement of Hsc70 and Hsp70 in mutant keratin degradation was demonstrated using CHIP-p.Met1_Ala142del (DeltaTPR-CHIP).
20146531 conformational changes in CHIP upon binding of Hsp70, Hsp90, and their respective C-terminal EEVD peptides, and in complex with the different E2 ubiquitin-conjugating enzymes UbcH5a and Ubc13
19940151 Hsp70- and CHIP-dependent ubiquitination represents a molecular mechanism by which prolonged hypoxia selectively reduces the levels of HIF-1alpha but not HIF-2alpha protein.
19892702 the co-chaperone carboxyl terminus of the Hsc70-interacting protein (CHIP) stabilizes malin by modulating the activity of Hsp70.
19648119 Data show by using an engineered version of the carboxyl terminus of Hsc70-interacting protein ubiquitin ligase as a research tool, we demonstrate a striking flexibility of ubiquitin conjugation that does not affect substrate specificity.
19536328 LRRK2 stability is regulated by the E3 ubiquitin ligase CHIP
19524548 CHIP serves as an E3 ubiquitin ligase that regulates Runx1 protein stability via an ubiquitination and degradation mechanism that is independent of Hsp70/90.
19483080 Data indicate that CHIP is a negative regulator of FoxO1 activity through ubiquitin-mediated degradation.
19362296 CHIP plays an important role in regulation iNOS activity.
19198599 CHIP inhibits anchorage-independent cell growth and metastatic potential by degrading oncogenic proteins including SRC-3.
19196961 Overexpression of CHIP protects against and knockdown of CHIP exacerbates toxicity mediated by mutant LRRK2
19165527 Using shotgun mass spectrometry, we found this protein differentially expressed in the dorsolateral prefrontal cortex from patients with schizophrenia.
19103148 both UBC7/gp78 and UbcH5a/CHIP may be involved in CYP3A4 ER-associated degradation, although their relative physiological contribution remains to be established
19098309 Csp not only regulates the exit of CFTR from the ER, but that this action is accompanied by Hsc70/Hsp70 and CHIP-mediated CFTR degradation.
18988734 Overexpression of CHIP protects mammalian cells from ricin intoxication by ubiquitylating ricin A chin in the context of Hsp90 binding.
18955503 This study reveals a critical role for CHIP in the aggresome pathway.
18784277 Function of deletion mutant shows that E3 ubiquitin ligases function redundantly.
18718056 Wild type CHIP induces mitotic abnormity in K562 cells.
18655187 Inhibition of tyrosine kinase activity of Her-2/neu by quercetin could indicate an lateration in the Her-2/neu structure which promotes CHIP recruitments and down-regulation of Her-2/neu
18436529 CHIP preferentially recognizes and mediates degradation of toxic, oligomeric forms of alphaSyn
18313385 Data show that CHIP-mediated degradation and DNA damage-dependent stabilization regulate base excision repair proteins XRCC1, DNA polymerase beta, and DNA ligase III.
18094050 These results indicate that the MKKS mutants have an abnormal conformation and that chaperone-dependent degradation mediated by CHIP is a key feature of McKusick-Kaufman syndrome/Bardet-Biedl syndrome diseases.
17963781 CHIP might preferentially regulate phosphorylated Smad1 and thus the BMP signaling
17962192 Ubiquitin ligase activity of CHIP is dispensable for Tal1/SCL binding but essential for degradation.
17666403 CHIP might be a direct chaperone of wild type p53 that helps p53 in maintaining wild type conformation under physiological condition as well as help resurrect p53 mutant phenotype into a folded native state under stress condition.
17545168 CHIP possesses an intrinsic chaperone activity that enables it to selectively recognize and bind nonnative proteins
17324930 DAPK is found in two distinct immune complexes, one containing HSP90 and CHIP and a second complex containing only DIP1/Mib; strict modulation of DAPK activities by HSP90 heterocomplexes is critical for regulation of apoptosis and cellular homeostasis
17304350 A critical mediator of Hsp90 inhibition leading to p-tau degradation is CHIP.
17157513 Dorfin-CHIP(L) rescued neuronal cells from mutant SOD1-associated toxicity and reduced the aggresome formation induced by mutant SOD1 more effectively than did Dorfin(WT).
17127076 Our findings suggest that the role of CHIP in aggregation of polyQ proteins greatly varies depending on the context of full-length polyQ proteins.
16831871 Results show that CHIP and ataxin-1 proteins directly interact and co-localize in nuclear inclusions both in cell culture and spinocerebellar ataxia type-1 postmortem neurons.
16725394 CHIP recognizes AR in a highly specific, phosphorylation- and sequence-dependent manner
16720573 Chip may be at least one ubiquitin E3 ligase responsible for eIF4E ubiquitination
16307917 CHIP is identified as a functional partner of Ubc13-Uev1a in formation of Lys63-linked polyubiquitin chains, extending CHIP's roles into ubiquitin regulation as well as targeted destruction.
16293251 CHIP directly interacts with C-terminal deleted HSF1 but not with full-length HSF1 under non-stressed conditions, and with full-length HSF1 under heat shock treatment; interaction requires conformational change of HSF1 by heat stress.
16207813 Hsc70 cochaperone BAG-2 as a main component of CHIP complexes. BAG-2 inhibits the ubiquitin ligase activity of CHIP.
16111477 Increases in CHIP may protect against neurofibrillary tangles formation in the early stages of Alzheimer's disease.
16037132 CHIP promotes ERalpha degradation and attenuates receptor-mediated gene transcription.
15911628 CHIP-induced degradation was observed for mutant and wild-type p53, which transiently associate with molecular chaperones Hsc70 and Hsp90 and can be diverted onto a degradation pathway through this association
15781469 findings suggest that CHIP can modulate the sensitivity of the TGF-beta signaling by controlling the basal level of Smad3 through ubiquitin-mediated degradation
15761032 CHIP is an E3 ligase that mediates alternative effects of the ubiquitin-proteasome pathway on glucocorticoid receptor down-regulation and transactivation
15466472 CHIP is an E3 ligase for nNOS whose action is facilitated by (and possibly requires) its interaction with nNOS-bound hsp70
15358145 Results suggest that co-chaperone CHIP, possibly with another E3 ligase(s), modulates the ubiquitylation of mutant Cu/Zn-superoxide dismutase and renders them more susceptible for proteasomal degradation.
15215316 HspBP1 interferes with the CHIP-induced degradation of immature forms of the cystic fibrosis transmembrane conductance regulator (CFTR) and stimulates CFTR maturation.
15107424 CHIP functions as a negative regulator of AR transcriptional activity by promoting AR degradation
15046863 In cells treated with dexamethasone and geldanamycin, the GFP-GR becomes concentrated in fluorescent globules located periodically along the neurites. CHIP protein concentrates in the same loci in a steroid-dependent and geldanamycin-dependent manner.
14962978 Hsp70/CHIP may play an important role in the pathogenesis of tauopathies
14701756 CHIP can interact with the Smad1/Smad4 proteins and block BMP signal transduction through the ubiquitin-mediated degradation of Smad proteins.
14612456 tau binds to Hsc70, and its phosphorylation is a recognition requirement for the addition of ubiquitin by the E3 Ub ligase CHIP
12574167 CHIP E3 controls both the association of Hsp70/Hsp90 chaperones with ErbB2 and the down-regulation of ErbB2 induced by inhibitors of Hsp90
12559985 Chip overexpression reduced the rate of AR degradation, consistent with an effect on AR folding,Chip affected AR folding was further supported by the finding that the effects of exogenous Chip were reproduced by a mutant lacking the U box
11805346 Ubiquitin ligases (u box) determine protein stability in a highly regulated manner by coordinating the addition of polyubiquitin chains to proteins that are then targeted to the proteasome for degradation.

AA Sequence

MKGKEEKEGGARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCY      1 - 70
LKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALR     71 - 140
IAKKKRWNSIEERRIHQESELHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMAD    141 - 210
MDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFDPVTRSPLTQEQL    211 - 280
IPNLAMKEVIDAFISENGWVEDY                                                   281 - 303
//

Text Mined References (197)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
26900751 2016 CHIP controls necroptosis through ubiquitylation- and lysosome-dependent degradation of RIPK3.
26658161 2016 The E3 ubiquitin ligase CHIP mediates ubiquitination and proteasomal degradation of PRMT5.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26330542 2015 Protein-Protein Interactions Modulate the Docking-Dependent E3-Ubiquitin Ligase Activity of Carboxy-Terminus of Hsc70-Interacting Protein (CHIP).
26321754 2015 CHIP Knockdown Reduced Heat Shock Response and Protein Quality Control Capacity in Lens Epithelial Cells.
26232501 2015 E3 ligase CHIP and Hsc70 regulate Kv1.5 protein expression and function in mammalian cells.
26219223 2015 Regulation of autophagic flux by CHIP.
26206088 2016 Phosphorylation of CHIP at Ser20 by Cdk5 promotes tAIF-mediated neuronal death.
26021863 2015 Decreased expression of CHIP leads to increased angiogenesis via VEGF-VEGFR2 pathway and poor prognosis in human renal cell carcinoma.
26010904 2015 Biochemical and Proteomic Analysis of Ubiquitination of Hsc70 and Hsp70 by the E3 Ligase CHIP.
25987026 2015 Clinicopathologic and Prognostic Significance of Carboxyl Terminus of Hsp70-interacting Protein in HBV-related Hepatocellular Carcinoma.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25879443 2015 ?F508 CFTR surface stability is regulated by DAB2 and CHIP-mediated ubiquitination in post-endocytic compartments.
25792747 2015 Carboxyl terminus of HSC70-interacting protein (CHIP) down-regulates NF-?B-inducing kinase (NIK) and suppresses NIK-induced liver injury.
25773675 2015 CHIP stabilizes amyloid precursor protein via proteasomal degradation and p53-mediated trans-repression of ?-secretase.
25684577 2015 A bipartite interaction between Hsp70 and CHIP regulates ubiquitination of chaperoned client proteins.
25672477 2015 The ubiquitin ligase CHIP inactivates NF-?B signaling and impairs the ability of migration and invasion in gastric cancer cells.
25635996 2015 MiR-1178 promotes the proliferation, G1/S transition, migration and invasion of pancreatic cancer cells by targeting CHIP.
25435366 2015 CHIP buffers heterogeneous Bcl-2 expression levels to prevent augmentation of anticancer drug-resistant cell population.
25416956 2014 A proteome-scale map of the human interactome network.
25260751 2014 The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines.
25258038 2014 STUB1 mutations in autosomal recessive ataxias - evidence for mutation-specific clinical heterogeneity.
25234599 2014 Ubiquitin ligase CHIP suppresses cancer stem cell properties in a population of breast cancer cells.
25225294 2014 Ubiquitination of inositol-requiring enzyme 1 (IRE1) by the E3 ligase CHIP mediates the IRE1/TRAF2/JNK pathway.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24912674 2014 The E3 ligase CHIP mediates ubiquitination and degradation of mixed-lineage kinase 3.
24742043 2014 Phenotype and frequency of STUB1 mutations: next-generation screenings in Caucasian ataxia and spastic paraplegia cohorts.
24722501 2014 CHIP is a novel tumor suppressor in pancreatic cancer through targeting EGFR.
24719489 2014 Autosomal recessive cerebellar ataxia of adult onset due to STUB1 mutations.
24661873 2014 C-Terminus of Hsc70-interacting protein regulates profilin1 and breast cancer cell migration.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24651434 2014 P42 Ebp1 regulates the proteasomal degradation of the p85 regulatory subunit of PI3K by recruiting a chaperone-E3 ligase complex HSP70/CHIP.
24613385 2014 Hsp70 and Hsp90 oppositely regulate TGF-? signaling through CHIP/Stub1.
24578159 2014 Carboxyl terminus of Hsp70-interacting protein regulation of osteoclast formation in mice through promotion of tumor necrosis factor receptor-associated factor 6 protein degradation.
24509416 2014 CHIP/Stub1 interacts with eIF5A and mediates its degradation.
24376685 2013 CHIP regulates AKT/FoxO/Bim signaling in MCF7 and MCF10A cells.
24370685 2014 Diverse roles of C-terminal Hsp70-interacting protein (CHIP) in tumorigenesis.
24312598 2013 Identification of CHIP as a novel causative gene for autosomal recessive cerebellar ataxia.
24302614 2014 CHIP/Stub1 functions as a tumor suppressor and represses NF-?B-mediated signaling in colorectal cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24251647 2014 Regulation of IL-4 receptor signaling by STUB1 in lung inflammation.
24113144 2014 Ataxia and hypogonadism caused by the loss of ubiquitin ligase activity of the U box protein CHIP.
24043303 2013 The ubiquitin ligase CHIP prevents SirT6 degradation through noncanonical ubiquitination.
23990462 2013 Endoplasmic reticulum protein quality control is determined by cooperative interactions between Hsp/c70 protein and the CHIP E3 ligase.
23973223 2013 The ubiquitin ligase Stub1 negatively modulates regulatory T cell suppressive activity by promoting degradation of the transcription factor Foxp3.
23963841 2013 Hsp90 prevents interaction between CHIP and HERG proteins to facilitate maturation of wild-type and mutant HERG proteins.
23904609 2013 USP47 and C terminus of Hsp70-interacting protein (CHIP) antagonistically regulate katanin-p60-mediated axonal growth.
23880665 2013 STUB1/CHIP is required for HIF1A degradation by chaperone-mediated autophagy.
23865999 2013 The E3 ubiquitin ligase CHIP and the molecular chaperone Hsc70 form a dynamic, tethered complex.
23764847 2013 CHIP has a protective role against oxidative stress-induced cell death through specific regulation of endonuclease G.
23679257 2013 Genetic screening for mutations in the chip gene in intracranial aneurysm patients of Chinese Han nationality.
23560854 2013 Ube2W conjugates ubiquitin to ?-amino groups of protein N-termini.
23431407 2013 Distinct roles of molecular chaperones HSP90? and HSP90? in the biogenesis of KCNQ4 channels.
23429937 2013 Metastatic lymph node CHIP expression is a potential prognostic marker for resected esophageal squamous cell carcinoma patients.
23410750 2013 C-terminus of Hsc70-interacting protein regulates C-terminal binding protein 2 and the expression of its target genes.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23344957 2013 Ca2+/S100 proteins act as upstream regulators of the chaperone-associated ubiquitin ligase CHIP (C terminus of Hsc70-interacting protein).
23322406 2013 STUB1 is essential for T-cell activation by ubiquitinating CARMA1.
23246967 2014 Androgen receptor degradation by the E3 ligase CHIP modulates mitotic arrest in prostate cancer cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22895543 2012 Decreased expression of the carboxyl terminus of heat shock cognate 70 interacting protein in human gastric cancer and its clinical significance.
22824801 2013 C-terminal phosphorylation of Hsp70 and Hsp90 regulates alternate binding to co-chaperones CHIP and HOP to determine cellular protein folding/degradation balances.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22670667 2013 The stability of wild-type and deletion mutants of human C-terminus Hsp70-interacting protein (CHIP).
22669480 2012 Alterations of the Hsp70/Hsp90 chaperone and the HOP/CHIP co-chaperone system in cancer.
22543587 2013 The ubiquitin ligase CHIP regulates c-Myc stability and transcriptional activity.
22535373 2013 CHIP functions as a novel suppressor of tumour angiogenesis with prognostic significance in human gastric cancer.
22492994 2012 Loss of HDAC6, a novel CHIP substrate, alleviates abnormal tau accumulation.
22433856 2012 Ubc13 and COOH terminus of Hsp70-interacting protein (CHIP) are required for growth hormone receptor endocytosis.
22427670 2012 The chaperone-assisted E3 ligase C terminus of Hsc70-interacting protein (CHIP) targets PTEN for proteasomal degradation.
22407479 2012 miR-764-5p promotes osteoblast differentiation through inhibition of CHIP/STUB1 expression.
22366786 2012 Mutations affecting the cytoplasmic functions of the co-chaperone DNAJB6 cause limb-girdle muscular dystrophy.
22190034 2011 Global landscape of HIV-human protein complexes.
22101235 2012 Multisite phosphorylation of human liver cytochrome P450 3A4 enhances Its gp78- and CHIP-mediated ubiquitination: a pivotal role of its Ser-478 residue in the gp78-catalyzed reaction.
22090276 2012 Menin missense mutants encoded by the MEN1 gene that are targeted to the proteasome: restoration of expression and activity by CHIP siRNA.
22038067 2011 BnRCH gene inhibits cell growth of Hela cells through increasing the G2 phase of cell cycle.
21995445 2012 Dab2 is a key regulator of endocytosis and post-endocytic trafficking of the cystic fibrosis transmembrane conductance regulator.
21911421 2011 E3 ubiquitin ligase CHIP facilitates Toll-like receptor signaling by recruiting and polyubiquitinating Src and atypical PKC{zeta}.
21855799 2011 Ube2w and ataxin-3 coordinately regulate the ubiquitin ligase CHIP.
21793045 2011 Ubiquitin ligase CHIP induces TRAF2 proteasomal degradation and NF-?B inactivation to regulate breast cancer cell invasion.
21710689 2011 Tid1, CHIP and ErbB2 interactions and their prognostic implications for breast cancer patients.
21478269 2011 Functional inactivation of endogenous MDM2 and CHIP by HSP90 causes aberrant stabilization of mutant p53 in human cancer cells.
21454478 2011 Molecular mechanism of the negative regulation of Smad1/5 protein by carboxyl terminus of Hsc70-interacting protein (CHIP).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21360678 2011 Label-free quantitative proteomics and SAINT analysis enable interactome mapping for the human Ser/Thr protein phosphatase 5.
21358815 2011 Ubiquitinylation of ?-synuclein by carboxyl terminus Hsp70-interacting protein (CHIP) is regulated by Bcl-2-associated athanogene 5 (BAG5).
21293491 2011 Control of AIF-mediated cell death by antagonistic functions of CHIP ubiquitin E3 ligase and USP2 deubiquitinating enzyme.
21272160 2011 Carboxyl terminus of Hsp70-interacting protein (CHIP) contributes to human glioma oncogenesis.
21269460 2011 Initial characterization of the human central proteome.
21220432 2011 E3 ligase STUB1/CHIP regulates NAD(P)H:quinone oxidoreductase 1 (NQO1) accumulation in aged brain, a process impaired in certain Alzheimer disease patients.
21124777 2010 The chaperone-dependent ubiquitin ligase CHIP targets HIF-1? for degradation in the presence of methylglyoxal.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20974249 2011 CHIP-dependent p53 regulation occurs specifically during cellular senescence.
20959453 2010 CHIP promotes human telomerase reverse transcriptase degradation and negatively regulates telomerase activity.
20947504 2011 Docking-dependent ubiquitination of the interferon regulatory factor-1 tumor suppressor protein by the ubiquitin ligase CHIP.
20924358 2010 Redox regulation of the stability of the SUMO protease SENP3 via interactions with CHIP and Hsp90.
20677910 2011 C-terminus of heat shock cognate 70 interacting protein increases following stroke and impairs survival against acute oxidative stress.
20661446 2010 Differential impact of tetratricopeptide repeat proteins on the steroid hormone receptors.
20618441 2010 CHIP participates in protein triage decisions by preferentially ubiquitinating Hsp70-bound substrates.
20588253 2010 CHIP-dependent termination of MEKK2 regulates temporal ERK activation required for proper hyperosmotic response.
20413784 2010 Promotion of CHIP-mediated p53 degradation protects the heart from ischemic injury.
20349136 2010 Heat shock protein 70 together with its co-chaperone CHIP inhibits TNF-alpha induced apoptosis by promoting proteasomal degradation of apoptosis signal-regulating kinase1.
20151404 2010 The ubiquitin ligase CHIP/STUB1 targets mutant keratins for degradation.
20146531 2010 Insights into the conformational dynamics of the E3 ubiquitin ligase CHIP in complex with chaperones and E2 enzymes.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19940151 2010 Hsp70 and CHIP selectively mediate ubiquitination and degradation of hypoxia-inducible factor (HIF)-1alpha but Not HIF-2alpha.
19892702 2010 Co-chaperone CHIP stabilizes aggregate-prone malin, a ubiquitin ligase mutated in Lafora disease.
19875381 2010 A proteomic investigation of ligand-dependent HSP90 complexes reveals CHORDC1 as a novel ADP-dependent HSP90-interacting protein.
19713937 2009 Ubiquitin ligase ARF-BP1/Mule modulates base excision repair.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19648119 2009 Engineering a ubiquitin ligase reveals conformational flexibility required for ubiquitin transfer.
19567782 2009 Hsp90 is an essential regulator of EphA2 receptor stability and signaling: implications for cancer cell migration and metastasis.
19536328 2009 Regulation of LRRK2 stability by the E3 ubiquitin ligase CHIP.
19524548 2009 CHIP functions an E3 ubiquitin ligase of Runx1.
19483080 2009 C terminus of Hsc70-interacting protein promotes smooth muscle cell proliferation and survival through ubiquitin-mediated degradation of FoxO1.
19423554 2009 Functional interaction of DYX1C1 with estrogen receptors suggests involvement of hormonal pathways in dyslexia.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19362296 2009 CHIP facilitates ubiquitination of inducible nitric oxide synthase and promotes its proteasomal degradation.
19198599 2009 The ubiquitin ligase CHIP acts as an upstream regulator of oncogenic pathways.
19196961 2009 CHIP regulates leucine-rich repeat kinase-2 ubiquitination, degradation, and toxicity.
19165527 2009 Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.
19103148 2009 CYP3A4 ubiquitination by gp78 (the tumor autocrine motility factor receptor, AMFR) and CHIP E3 ligases.
19098309 2009 Cysteine string protein promotes proteasomal degradation of the cystic fibrosis transmembrane conductance regulator (CFTR) by increasing its interaction with the C terminus of Hsp70-interacting protein and promoting CFTR ubiquitylation.
18988734 2008 Cytosolic chaperones influence the fate of a toxin dislocated from the endoplasmic reticulum.
18955503 2009 A critical role for CHIP in the aggresome pathway.
18784277 2008 CHIP deletion reveals functional redundancy of E3 ligases in promoting degradation of both signaling proteins and expanded glutamine proteins.
18718056 2008 [Overexpression of CHIP in chronic myeloid leukemia K562 cells induces mitotic abnormality].
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18655187 2008 Quercetin-induced ubiquitination and down-regulation of Her-2/neu.
18485199 2008 Interactions between the quality control ubiquitin ligase CHIP and ubiquitin conjugating enzymes.
18436529 2008 CHIP targets toxic alpha-Synuclein oligomers for degradation.
18411298 2008 CHIP deficiency decreases longevity, with accelerated aging phenotypes accompanied by altered protein quality control.
18313385 2008 CHIP-mediated degradation and DNA damage-dependent stabilization regulate base excision repair proteins.
18094050 2008 MKKS is a centrosome-shuttling protein degraded by disease-causing mutations via CHIP-mediated ubiquitination.
18042044 2008 Two different classes of E2 ubiquitin-conjugating enzymes are required for the mono-ubiquitination of proteins and elongation by polyubiquitin chains with a specific topology.
17963781 2007 Differential ubiquitination of Smad1 mediated by CHIP: implications in the regulation of the bone morphogenetic protein signaling pathway.
17962192 2008 Ubiquitination and degradation of Tal1/SCL are induced by notch signaling and depend on Skp2 and CHIP.
17666403 2007 CHIP chaperones wild type p53 tumor suppressor protein.
17545168 2007 Chaperone functions of the E3 ubiquitin ligase CHIP.
17512523 2007 Parkin interacts with LIM Kinase 1 and reduces its cofilin-phosphorylation activity via ubiquitination.
17324930 2007 Regulation of death-associated protein kinase. Stabilization by HSP90 heterocomplexes.
17317785 2007 CHIP and HSPs interact with beta-APP in a proteasome-dependent manner and influence Abeta metabolism.
17304350 2007 The high-affinity HSP90-CHIP complex recognizes and selectively degrades phosphorylated tau client proteins.
17209571 2007 Carboxyl terminus of hsc70-interacting protein (CHIP) can remodel mature aryl hydrocarbon receptor (AhR) complexes and mediate ubiquitination of both the AhR and the 90 kDa heat-shock protein (hsp90) in vitro.
17157513 2007 Dorfin-CHIP chimeric proteins potently ubiquitylate and degrade familial ALS-related mutant SOD1 proteins and reduce their cellular toxicity.
17127076 2007 Co-chaperone CHIP promotes aggregation of ataxin-1.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16895519 2006 Ubiquitin-proteasome degradation of serum- and glucocorticoid-regulated kinase-1 (SGK-1) is mediated by the chaperone-dependent E3 ligase CHIP.
16831871 2006 CHIP protects from the neurotoxicity of expanded and wild-type ataxin-1 and promotes their ubiquitination and degradation.
16809764 2006 Histone deacetylase 8 safeguards the human ever-shorter telomeres 1B (hEST1B) protein from ubiquitin-mediated degradation.
16725394 2006 The E3 ubiquitin ligase CHIP binds the androgen receptor in a phosphorylation-dependent manner.
16720573 2006 Ubiquitination and proteasome-dependent degradation of human eukaryotic translation initiation factor 4E.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16554822 2006 CHIP-mediated stress recovery by sequential ubiquitination of substrates and Hsp70.
16307917 2005 Chaperoned ubiquitylation--crystal structures of the CHIP U box E3 ubiquitin ligase and a CHIP-Ubc13-Uev1a complex.
16293251 2005 CHIP interacts with heat shock factor 1 during heat stress.
16280320 2006 DPM1, the catalytic subunit of dolichol-phosphate mannose synthase, is tethered to and stabilized on the endoplasmic reticulum membrane by DPM3.
16275660 2006 Identification of VCP/p97, carboxyl terminus of Hsp70-interacting protein (CHIP), and amphiphysin II interaction partners using membrane-based human proteome arrays.
16207813 2005 BAG-2 acts as an inhibitor of the chaperone-associated ubiquitin ligase CHIP.
16169850 2005 Regulation of the cytoplasmic quality control protein degradation pathway by BAG2.
16111477 2005 In vivo evidence of CHIP up-regulation attenuating tau aggregation.
16037132 2005 CHIP (carboxyl terminus of Hsc70-interacting protein) promotes basal and geldanamycin-induced degradation of estrogen receptor-alpha.
15911628 2005 The chaperone-associated ubiquitin ligase CHIP is able to target p53 for proteasomal degradation.
15845543 2005 The co-chaperone carboxyl terminus of Hsp70-interacting protein (CHIP) mediates alpha-synuclein degradation decisions between proteasomal and lysosomal pathways.
15781469 2005 CHIP controls the sensitivity of transforming growth factor-beta signaling by modulating the basal level of Smad3 through ubiquitin-mediated degradation.
15761032 2005 Alternative effects of the ubiquitin-proteasome pathway on glucocorticoid receptor down-regulation and transactivation are mediated by CHIP, an E3 ligase.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466472 2004 Ubiquitylation of neuronal nitric-oxide synthase by CHIP, a chaperone-dependent E3 ligase.
15358145 2004 Co-chaperone CHIP associates with mutant Cu/Zn-superoxide dismutase proteins linked to familial amyotrophic lateral sclerosis and promotes their degradation by proteasomes.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15215316 2004 The cochaperone HspBP1 inhibits the CHIP ubiquitin ligase and stimulates the maturation of the cystic fibrosis transmembrane conductance regulator.
15198682 2004 CHIP promotes proteasomal degradation of familial ALS-linked mutant SOD1 by ubiquitinating Hsp/Hsc70.
15107424 2004 An androgen receptor NH2-terminal conserved motif interacts with the COOH terminus of the Hsp70-interacting protein (CHIP).
15046863 2004 Retrograde transport of the glucocorticoid receptor in neurites requires dynamic assembly of complexes with the protein chaperone hsp90 and is linked to the CHIP component of the machinery for proteasomal degradation.
14962978 2004 CHIP and Hsp70 regulate tau ubiquitination, degradation and aggregation.
14701756 2004 CHIP mediates degradation of Smad proteins and potentially regulates Smad-induced transcription.
14612456 2004 CHIP-Hsc70 complex ubiquitinates phosphorylated tau and enhances cell survival.
12832480 2003 Overexpression of the cochaperone CHIP enhances Hsp70-dependent folding activity in mammalian cells.
12574167 2003 ErbB2 degradation mediated by the co-chaperone protein CHIP.
12559985 2003 C-terminal Hsp-interacting protein slows androgen receptor synthesis and reduces its rate of degradation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200376 2002 Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.
12150907 2002 CHIP is associated with Parkin, a gene responsible for familial Parkinson's disease, and enhances its ubiquitin ligase activity.
11743028 2001 CHIP is a chaperone-dependent E3 ligase that ubiquitylates unfolded protein.
11557750 2001 CHIP is a U-box-dependent E3 ubiquitin ligase: identification of Hsc70 as a target for ubiquitylation.
11435423 2001 U box proteins as a new family of ubiquitin-protein ligases.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
11146632 2001 The co-chaperone CHIP regulates protein triage decisions mediated by heat-shock proteins.
10330192 1999 Identification of CHIP, a novel tetratricopeptide repeat-containing protein that interacts with heat shock proteins and negatively regulates chaperone functions.
9610721 1998 Characterization of human colon cancer antigens recognized by autologous antibodies.