Property Summary

NCBI Gene PubMed Count 23
PubMed Score 50.40
PubTator Score 30.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
pancreatic cancer 1.300 2.0e-02
Multiple myeloma 1.404 8.6e-04
osteosarcoma 1.448 4.6e-03
posterior fossa group B ependymoma 1.500 2.9e-06
glioblastoma 1.200 1.3e-04
group 3 medulloblastoma 1.700 1.9e-03
cystic fibrosis 1.291 8.4e-06
non-small cell lung cancer 1.004 1.5e-14
pancreatic carcinoma 1.300 2.0e-02
lung adenocarcinoma 1.238 3.3e-07
ovarian cancer 1.500 7.7e-04
Gaucher disease type 3 1.100 5.8e-03

Protein-protein Interaction (1)

Gene RIF (6)

PMID Text
25029371 Consensus sites containing large hydrophobic and negatively charged middle residues are frequently skipped by STT3A during protein translation.
23842455 Results show homozygous mutation in STT3A and in STT3B causes congenital disorders of glycosylation.
22157935 DDIT3, STT3A, ARG2 and FAM129A immunohistochemistry does not appear to be useful in the diagnosis of thyroid follicular neoplasias, as they do not reliably distinguish follicular thyroid carcinoma from follicular thyroid adenoma.
21520112 Gene-expression data suggest a difference in expression between STT3A, Clorf24, and TFF3 in FAs versus carcinomas that may be detected from an FNA sample. Findings must be validated from preoperative FNAs in larger numbers
19167329 The STT3A OST isoform is primarily responsible for cotranslational glycosylation of the nascent polypeptide as it enters the lumen of the endoplasmic reticulum.
18187620 Knockdown of STT3, subunit of the oligosaccharyltransferase complex, homolog A (STT3A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFLAEEGFYKFHN      1 - 70
WFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLAPLFSSFTTIVTYHLTKELKD     71 - 140
AGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTYYMWIKAVKTGSICWAAKCALAYFYMVSSWG    141 - 210
GYVFLINLIPLHVLVLMLTGRFSHRIYVAYCTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIH    211 - 280
AFVDYLRSKLNPQQFEVLFRSVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVS    281 - 350
EHQPTTWSSYYFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI    351 - 420
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTSEAYSSPSIVL    421 - 490
SARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTILVDNNTWNNTHISRVGQAMA    491 - 560
STEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMVRIGGSTDTGKHIKENDYYTPTGEFRVDREG    561 - 630
SPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNR    631 - 700
GLSRT                                                                     701 - 705
//

Text Mined References (31)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25792706 2015 Reduced expression of the oligosaccharyltransferase exacerbates protein hypoglycosylation in cells lacking the fully assembled oligosaccharide donor.
25579050 2015 Evidence for schizophrenia susceptibility alleles in the Indian population: An association of neurodevelopmental genes in case-control and familial samples.
25460543 2015 Cotranslational and posttranslocational N-glycosylation of proteins in the endoplasmic reticulum.
25135935 2014 Oxidoreductase activity is necessary for N-glycosylation of cysteine-proximal acceptor sites in glycoproteins.
25029371 2014 The middle X residue influences cotranslational N-glycosylation consensus site skipping.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23842455 2013 Mutations in STT3A and STT3B cause two congenital disorders of glycosylation.
23453885 2013 Identification of risk loci with shared effects on five major psychiatric disorders: a genome-wide analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22157935 2012 The new molecular markers DDIT3, STT3A, ARG2 and FAM129A are not useful in diagnosing thyroid follicular tumors.
22016385 2011 Selenoprotein K binds multiprotein complexes and is involved in the regulation of endoplasmic reticulum homeostasis.
21926974 2011 Genome-wide association study identifies five new schizophrenia loci.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21520112 2011 STT3A, C1orf24, TFF3: putative markers for characterization of follicular thyroid neoplasms from fine-needle aspirates.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19167329 2009 Cotranslational and posttranslational N-glycosylation of polypeptides by distinct mammalian OST isoforms.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15835887 2005 Proteomic analysis of mammalian oligosaccharyltransferase reveals multiple subcomplexes that contain Sec61, TRAP, and two potential new subunits.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12887896 2003 Oligosaccharyltransferase isoforms that contain different catalytic STT3 subunits have distinct enzymatic properties.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10234787 1999 Schizosaccharomyces pombe stt3+ is a functional homologue of Saccharomyces cerevisiae STT3 which regulates oligosaccharyltransferase activity.
8941377 1996 Assignment of the human integral transmembrane protein 1 gene (ITM1) to human chromosome band 11q23.3 by in situ hybridization and YAC mapping.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8838310 1996 Molecular cloning of a highly conserved mouse and human integral membrane protein (Itm1) and genetic mapping to mouse chromosome 9.
8634329 1996 Isolation, characterization, and mapping to human chromosome 11q24-25 of a cDNA encoding a highly conserved putative transmembrane protein, TMC.