Property Summary

NCBI Gene PubMed Count 86
PubMed Score 353.73
PubTator Score 1212.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
urothelial carcinoma -1.300 1.2e-02
malignant mesothelioma -1.900 7.4e-06
astrocytic glioma -2.400 1.6e-02
posterior fossa group B ependymoma -1.700 2.4e-10
oligodendroglioma -1.200 4.5e-11
psoriasis 1.900 8.3e-03
osteosarcoma 1.741 6.5e-05
glioblastoma -1.600 9.2e-03
medulloblastoma -2.400 8.1e-06
atypical teratoid / rhabdoid tumor -2.600 1.2e-05
medulloblastoma, large-cell -1.900 3.8e-03
primitive neuroectodermal tumor -1.800 2.8e-03
acute quadriplegic myopathy 2.085 1.0e-07
Atopic dermatitis -1.300 4.5e-03
tuberculosis 1.100 4.4e-04
intraductal papillary-mucinous adenoma (... 2.000 4.0e-03
intraductal papillary-mucinous neoplasm ... 3.800 1.7e-03
lung cancer -1.500 1.2e-04
active Crohn's disease 2.258 4.5e-03
ulcerative colitis 2.600 8.4e-04
pancreatic cancer 1.300 1.3e-04
adult high grade glioma -1.500 7.6e-03
invasive ductal carcinoma -1.149 1.5e-03
nasopharyngeal carcinoma -1.100 4.1e-04
Alzheimer's disease -1.100 3.2e-02
Pick disease -1.400 8.8e-04

 OMIM Phenotype (1)

 CSPA Cell Line (2)

Gene RIF (69)

PMID Text
26723541 Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells
26631368 The antagonistic actions of glucocorticoids and NFkB on STS expression are similar to the regulation of inflammatory response proteins
26458420 Data show that both estrogen sulfatase (STS) and estrogen sulfotransferase (EST) were highly expressed in the human umbilical vein endothelial cells (HUVECs).
26421812 Letter/Case Report: novel nonsense mutation in the STS gene in X-linked ichthyosis.
26220752 The induced STS facilitates the conversion of inactive estrogen sulfates to active estrogens, which in return attenuates the NF-kappaB-mediated inflammation.
26213785 represents one of the major pathways in regenerating biologically active steroids in both steroidogenic and nonsteroidogenic tissues [review]
26194504 In both arm and subumbilical skin biopsy of patients with idiopathic hirsutism, there was an up-regulation of STS mRNA expression.
25726327 Our analyses show that the two phenotypes in our patient are due to independent genetic defects: a genomic rearrangement involving the Kallmann syndrome 1 gene and a point mutation of the steryl-sulfatase gene.
25499601 Genetic variation in ARSC may be associated with change in mammographic density after women stop using estrogen-progestin therapy.
25042472 STS is present in human pre-osteoblastic bone cells and that it can influence bone cell growth
24480088 complete deletion in Pakistani families with x-linked ichthyosis
24081738 Data suggest that expression of STS and 17beta-hydroxysteroid dehydrogenase isoenzymes is up-regulated in subcutaneous abdominal fat of morbidly obese women as compared with morbidly obese men.
24055520 IGF-II induces steroid sulfatase expression via a PI3-kinase/Akt-NF-kappaB signaling pathway in PC-3 cells and may induce estrogen production and estrogen-mediated carcinogenesis.
23916543 results suggest that steroid sulfatase expression can be decreased in the process of large intestinal carcinogenesis
23861462 Genetic variants in SULT2A1, PAPSS2, and STS do not predispose to polycystic ovary syndrome.
23807007 Microdeletion within Xp22.3 containing STS with aCGH in an individual with suspected pre-Descemet corneal dystrophy and X-linked ichthyosis demonstrates the clinical utility of copy number variation analysis.
23122578 no difference in placental activity found between women with polycystic ovarian syndrome and controls
21945601 Filaggrin defects can synergize with steroid sulfatase deficiency to exacerbate the ichthyosis phenotype.
21693170 This timely review concentrates on recent advances in steroid sulfatase research.
21530180 Case Report: Report novel point mutation in the STS gene in a patient with X-linked recessive ichthyosis.
21255266 Genetic variants affecting steroid sulfatase expression and/or activity could influence the function of brain regions perturbed in attention deficit hyperactivity disorder (ADHD).
21073915 Recent results of STS and EST in several estrogen-dependent carcinomas, are summarised.
20862695 Genetic variation in the STS gene may be implicated in ADHD susceptibility and one polymorphism may be associated with lower STS mRNA expression as well as being more prevalent in female ADHD homozygotes.
20862695 Observational study of gene-disease association. (HuGE Navigator)
20814163 Six novel single nucleotide polymorphisms of the steroid sulfatase gene in a Japanese population.
20236202 Recessive X-linked ichthyosis is caused by a deficiency in steroid sulphatase (STS), whose gene has been located on the X chromosome.
20236202 Observational study of gene-disease association. (HuGE Navigator)
20214802 Observational study of gene-disease association. (HuGE Navigator)
20151319 A significant increment of STS followed exemestane neoadjuvant therapy of postmenopausal ER-positive breast carcinoma. This may represent the compensatory response of breast carcinoma tissues to estrogen depletion.
20149601 Both steroid sulfatase and filaggrin mutations are found in X-linked ichthyosis.
19598235 Observational study of gene-disease association. (HuGE Navigator)
19551860 Observational study of gene-disease association. (HuGE Navigator)
19453261 Observational study of gene-disease association. (HuGE Navigator)
19429462 two new splicing patterns found in prostate and ovary cells; report gene expression analysis for the simultaneous detection, in qualitative and/or semi-quantitative terms, of the transcription patterns of STS in different tissues
19347708 An association between menopausal status - but not BMI - and the intra-tumoral expression of steroid sulfatase and ERalpha.
19200188 Clinical manifestations of XLI are due to a great variety of environmental, genetic and individual factors
19124506 Observational study of gene-disease association. (HuGE Navigator)
18937300 Association of STS gene with ADHD is reported.
18937300 Observational study of gene-disease association. (HuGE Navigator)
18817841 The involvement of aromatase, steroid sulfatase (STS) and reductive 17beta-hydroxysteroid dehydrogenases (17beta-HSDs) in the production of estrogens was determined in four cell lines of endometrial cancer and one cell line of cervix cancer.
18723074 The activity levels of 17beta-hydroxysteroid dehydrogenase (17beta-HSD), 3beta-hydroxysteroid dehydrogenase (3beta-HSD), 3alpha-hydroxysteroid dehydrogenase (3alpha-HSD/3-KSR) and estrone sulfatase in ovarian epithelial carcinomas, were assayed.
18467089 Sata showed lower levels of STS mRNA for polycystic ovarian syndrome endometria without treatment and with endometrial hyperplasia compared to control.
18413370 STS deficiency may be a risk factor for ADHD with predominantly inattentive symptoms; Boys with XLI and large deletions encompassing STS and NLGN4 are at increased risk of developing autism and related disorders.
18343103 Cholesterol sulphate sulphohydrolase was isolated from placenta lysosomal membrane, with a high specificity to cholesterol sulphate, pI at 5.7, molecular weight 38 kDa, and pH preference at 3.
18249534 differences in STS and SULT activity in brain tumors (glioblastomas, pituitary adenomas, meningiomas, astrocytomas)
18180093 Analysis of the mutated STS protein showed that N- and C-terminal truncated STS constructs are inactive.
17601726 the regulation of STS transcription appears to be more complex than previously thought, suggesting that this enzyme plays a substantial role in intercellular integration.
17481887 Estradiol inhibits the estrone sulfatase activity in normal and cancerous human breast tissues.
17454161 Sulfatase was significantly upregulated in ovarian tissue of patients with ovarian endometriosis.
17426092 Observational study of gene-disease association. (HuGE Navigator)
17426092 genetic evidence suggesting a potential role of SULT2A1, but not STS, in the inherited adrenal androgen excess of polycystic ovary syndrome
17415442 Activity of this enzyme in endometrial cancer obtained by tritium-labeled steroids.
16556483 Steroid sulfatase mRNA level was significantly higher in soft tissue metastases than in primary tumors.
16467490 Corticotrophin-releasing hormone (CRH) increased whereas alpha-helical CRH decreased the mRNA levels of STS, CYP19A1, and HSD17B1, the key enzymes for estrogen synthesis.
16399357 Studies on the localization of steroid sulfatase were performed.
16084891 Findings of steroid sulfatase localized in the cytoplasm of the cumulus cells and expression of STS mRNA suggest a local steroidal regulation mechanism in cumulus cells.
15355916 Increased steroid sulfatase expression is associated with estrogen-dependent endometrial carcinomas
15302278 Gonadotropin-releasing hormone agonist (leuprolide)inhibits estrone sulfatase expression in cystic endometriosis in the ovary.
15152080 Dehydroepiandrosterone blood levels are influenced by a steroid sulfatase polymorphism following acute resistance exercise.
15056284 Strong activity and mRNA expression of DHEAS desulfating STS was found, twice as high in cerebral neocortex than in subcortical white matter. Cerebral STS resembled the characteristics of the known placental enzyme
15009711 SSase is concentrated in lamellar bodies (LB), and secreted into the SC interstices, along with other LB-derived lipid hydrolases. There, it degrades CSO4, generating some cholesterol for the barrier
14969586 Steroid sulfatase increases steroid acute regulatory protein expression level and stimulates steroid production.
14556660 estrogen-dependent cell growth of the estrogen sulfatase-transfected cell clones was found to be abolished, due to the enhanced sulfoconjugation of estrogen
14507642 Levels of STS and estrogen sulfotransferase mRNA and activity may be significantly associated with degree of atherosclerotic changes in female aorta, which may be related to cytokines produced in situ, such as IL-1beta, in human atherosclerotic lesions.
12657638 The structure of this enzyme, purified from the microsomal fraction of human placentas, determined by x-ray crystallography.
12231117 data demonstrate that LNCaP prostate cancer cells contain a steryl sulfatase with properties similar to that found in human breast cancer cells
11996939 Regulation of estrogen activity in human endometrium: effect of IL-1beta on steroid sulfatase activity in human endometrial stromal cells.
11886493 in the human hair follicle, concentrates in the dermal papilla.
11844872 Analysis of deletions indicates complex origin, apart from homologous recombination, of deletion mutants.

AA Sequence

MPLRKMKIPFLLLFFLWEAESHAASRPNIILVMADDLGIGDPGCYGNKTIRTPNIDRLASGGVKLTQHLA      1 - 70
ASPLCTPSRAAFMTGRYPVRSGMASWSRTGVFLFTASSGGLPTDEITFAKLLKDQGYSTALIGKWHLGMS     71 - 140
CHSKTDFCHHPLHHGFNYFYGISLTNLRDCKPGEGSVFTTGFKRLVFLPLQIVGVTLLTLAALNCLGLLH    141 - 210
VPLGVFFSLLFLAALILTLFLGFLHYFRPLNCFMMRNYEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPF    211 - 280
LLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEV    281 - 350
SSKGEIHGGSNGIYKGGKANNWEGGIRVPGILRWPRVIQAGQKIDEPTSNMDIFPTVAKLAGAPLPEDRI    351 - 420
IDGRDLMPLLEGKSQRSDHEFLFHYCNAYLNAVRWHPQNSTSIWKAFFFTPNFNPVGSNGCFATHVCFCF    421 - 490
GSYVTHHDPPLLFDISKDPRERNPLTPASEPRFYEILKVMQEAADRHTQTLPEVPDQFSWNNFLWKPWLQ    491 - 560
LCCPSTGLSCQCDREKQDKRLSR                                                   561 - 583
//

Text Mined References (87)

PMID Year Title
26723541 2016 Effects of steroid hormone on estrogen sulfotransferase and on steroid sulfatase expression in endometriosis tissue and stromal cells.
26631368 2016 Steroid sulfatase in the human MG-63 preosteoblastic cell line: Antagonistic regulation by glucocorticoids and NF?B.
26458420 2015 Melatonin affects the dynamic steady-state equilibrium of estrogen sulfates in human umbilical vein endothelial cells by regulating the balance between estrogen sulfatase and sulfotransferase.
26421812 2015 X-linked ichthyosis in a patient with a novel nonsense mutation in the STS gene.
26220752 2016 Inflammatory regulation of steroid sulfatase: A novel mechanism to control estrogen homeostasis and inflammation in chronic liver disease.
26213785 2015 The Regulation of Steroid Action by Sulfation and Desulfation.
26194504 2015 Is idiopathic hirsutism (IH) really idiopathic? mRNA expressions of skin steroidogenic enzymes in women with IH.
25726327 2015 Ichthyosis and Kallmann syndrome: not always a contiguous gene syndrome.
25499601 2014 Hormone metabolism pathway genes and mammographic density change after quitting estrogen and progestin combined hormone therapy in the California Teachers Study.
25042472 2014 Steroid sulfatase mediated growth Sof human MG-63 pre-osteoblastic cells.
24480088 2014 Molecular study of X-linked ichthyosis: report of a novel 2-bp insertion mutation in the STS and a very rare case of homozygous female patient.
24081738 2013 17?-Estradiol and estradiol fatty acyl esters and estrogen-converting enzyme expression in adipose tissue in obese men and women.
24055520 2013 Induction of steroid sulfatase expression in PC-3 human prostate cancer cells by insulin-like growth factor II.
23916543 2013 Reduced expression of steroid sulfatase in primary colorectal cancer.
23861462 2013 Variants in SULT2A1 affect the DHEA sulphate to DHEA ratio in patients with polycystic ovary syndrome but not the hyperandrogenic phenotype.
23807007 2013 Pre-Descemet corneal dystrophy and X-linked ichthyosis associated with deletion of Xp22.31 containing the STS gene.
23122578 2013 Placental steroidogenesis in pregnant women with polycystic ovary syndrome.
21945601 2011 Exacerbation of X-linked ichthyosis phenotype in a female by inheritance of filaggrin and steroid sulfatase mutations.
21693170 2011 Steroid sulfatase: a pivotal player in estrogen synthesis and metabolism.
21530180 2011 Novel point mutation in the STS gene in a patient with X-linked recessive ichthyosis.
21255266 2011 Steroid sulfatase is a potential modifier of cognition in attention deficit hyperactivity disorder.
21073915 2011 Steroid sulfatase and estrogen sulfotransferase in human carcinomas.
20862695 2010 Polymorphisms of the steroid sulfatase (STS) gene are associated with attention deficit hyperactivity disorder and influence brain tissue mRNA expression.
20814163 2010 Six novel single nucleotide polymorphisms of the steroid sulfatase gene in a Japanese population.
20236202 2010 Analysis of the STS gene in 40 patients with recessive X-linked ichthyosis: a high frequency of partial deletions in a Spanish population.
20214802 2010 Genetic variation in the estrogen metabolic pathway and mammographic density as an intermediate phenotype of breast cancer.
20151319 2010 Increased estrogen sulfatase (STS) and 17beta-hydroxysteroid dehydrogenase type 1(17beta-HSD1) following neoadjuvant aromatase inhibitor therapy in breast cancer patients.
20149601 2010 Evidence for genetic modifiers other than filaggrin mutations in X-linked ichthyosis.
19598235 2009 Genes related to sex steroids, neural growth, and social-emotional behavior are associated with autistic traits, empathy, and Asperger syndrome.
19551860 2009 Common germline polymorphisms in COMT, CYP19A1, ESR1, PGR, SULT1E1 and STS and survival after a diagnosis of breast cancer.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19429462 2009 Transcriptional control of human steroid sulfatase.
19347708 2009 Correlation of body mass index and menopausal status with the intra-tumoral estrogen system in invasive breast cancer.
19200188 2009 Atypical X-linked ichthyosis in a patient with a large deletion involving the steroid sulfatase (STS) gene.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18937300 2008 Association of the steroid sulfatase (STS) gene with attention deficit hyperactivity disorder.
18817841 2009 Estrogen formation in endometrial and cervix cancer cell lines: involvement of aromatase, steroid sulfatase and 17beta-hydroxysteroid dehydrogenases (types 1, 5, 7 and 12).
18723074 2009 Steroid-converting enzymes in human ovarian carcinomas.
18467089 2008 In situ estrogen metabolism in proliferative endometria from untreated women with polycystic ovarian syndrome with and without endometrial hyperplasia.
18413370 2008 X-linked ichthyosis (steroid sulfatase deficiency) is associated with increased risk of attention deficit hyperactivity disorder, autism and social communication deficits.
18343103 2008 Cholesterol sulphate sulphohydrolase of human placenta lysosomal membrane.
18249534 2008 Steroid sulfatase and sulfuryl transferase activities in human brain tumors.
18180093 2008 Effects of mutations and glycosylations on STS activity: a site-directed mutagenesis study.
17601726 2007 The expression of the human steroid sulfatase-encoding gene is driven by alternative first exons.
17596930 Tissue-specific transcripts of human steroid sulfatase are under control of estrogen signaling pathways in breast carcinoma.
17481887 2007 Estradiol inhibits the estrone sulfatase activity in normal and cancerous human breast tissues.
17454161 2007 Expression analysis of the genes involved in estradiol and progesterone action in human ovarian endometriosis.
17426092 2007 Genes for enzymes regulating dehydroepiandrosterone sulfonation are associated with levels of dehydroepiandrosterone sulfate in polycystic ovary syndrome.
17415442 2006 Synthesis of highly tritium labeled steroids for evaluation of aromatase and steroidsulfatase activities in endometrial tumors.
16837617 2006 Tissue-specific transcriptional initiation and activity of steroid sulfatase complementing dehydroepiandrosterone sulfate uptake and intracrine steroid activations in human adipose tissue.
16556483 2006 Quantitative analysis of aromatase, sulfatase and 17beta-HSD(1) mRNA expression in soft tissue metastases of breast cancer.
16467490 2006 Corticotropin-releasing hormone stimulates estrogen biosynthesis in cultured human placental trophoblasts.
16399357 2005 Analysis for localization of steroid sulfatase in human tissues.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16084891 2005 Strong expression of steroid sulfatase in human cumulus cells in patients with endometriosis.
15962010 2005 Sulphatase activities are regulated by the interaction of sulphatase-modifying factor 1 with SUMF2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15355916 2004 Steroid sulfatase and estrogen sulfotransferase in human endometrial carcinoma.
15302278 2004 Gonadotropin-releasing hormone agonist inhibits estrone sulfatase expression of cystic endometriosis in the ovary.
15152080 2004 Steroid sulfatase gene variation and DHEA responsiveness to resistance exercise in MERET.
15056284 2004 Steroid sulfatase (STS) expression in the human temporal lobe: enzyme activity, mRNA expression and immunohistochemistry study.
15009711 2004 Basis for abnormal desquamation and permeability barrier dysfunction in RXLI.
14969586 2004 The potential function of steroid sulphatase activity in steroid production and steroidogenic acute regulatory protein expression.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14556660 2003 Estrogen sulfotransferase and sulfatase: Roles in the regulation of estrogen activity in human uterine endometrial carcinomas.
14507642 2003 Steroid sulfatase and estrogen sulfotransferase in the atherosclerotic human aorta.
12657638 2003 Structure of human estrone sulfatase suggests functional roles of membrane association.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12231117 2002 Inhibition of steryl sulfatase activity in LNCaP human prostate cancer cells.
11996939 2002 Regulation of estrogen activity in human endometrium: effect of IL-1beta on steroid sulfatase activity in human endometrial stromal cells.
11844872 2001 Deletion pattern of the STS gene in X-linked ichthyosis in a Mexican population.
10844566 2000 Novel point mutations in the steroid sulfatase gene in patients with X-linked ichthyosis: transfection analysis using the mutated genes.
10679952 2000 PCR diagnosis of X-linked ichthyosis: identification of a novel mutation (E560P) of the steroid sulfatase gene.
9252398 1997 Characterization of point mutations in patients with X-linked ichthyosis. Effects on the structure and function of the steroid sulfatase protein.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
6957717 1982 Differential expression of steroid sulphatase locus on active and inactive human X chromosome.
6948769 1981 Further evidence for the assignment of the steroid sulfatase X-linked ichthyosis locus to the telomer of Xp.
3471087 1987 Tissue-specific expression of human arylsulfatase-C isozymes and steroid sulfatase.
3464600 1986 Association of steroid sulfatase with one of the arylsulfatase C isozymes in human fibroblasts.
3203382 1988 The human X-linked steroid sulfatase gene and a Y-encoded pseudogene: evidence for an inversion of the Y chromosome during primate evolution.
3165728 1988 X/Y translocation in a family with X-linked ichthyosis, chondrodysplasia punctata, and mental retardation: DNA analysis reveals deletion of the steroid sulphatase gene and translocation of its Y pseudogene.
3034252 1987 Genetic heterogeneity of steroid sulfatase deficiency revealed with cDNA for human steroid sulfatase.
3032454 1987 Cloning and expression of steroid sulfatase cDNA and the frequent occurrence of deletions in STS deficiency: implications for X-Y interchange.
2765556 1989 Characterization of rat and human steroid sulfatases.
2668275 1989 Cloning and expression of human steroid-sulfatase. Membrane topology, glycosylation, and subcellular distribution in BHK-21 cells.
2065092 1991 Characterization of arylsulfatase C isozymes from human liver and placenta.
1539590 1992 Identification of point mutations in the steroid sulfatase gene of three patients with X-linked ichthyosis.