Property Summary

NCBI Gene PubMed Count 26
PubMed Score 3.91
PubTator Score 6.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (7)

Disease log2 FC p
pancreatic cancer 1.100 3.7e-02
oligodendroglioma -1.500 3.4e-02
psoriasis 1.100 1.8e-03
osteosarcoma 1.453 3.7e-04
acute quadriplegic myopathy 1.268 3.1e-04
pancreatic carcinoma 1.100 3.7e-02
ovarian cancer 1.200 1.1e-02

Pathway (1)

Gene RIF (5)

PMID Text
26022125 results demonstrate that XBP1 mRNA splicing plays an important role in maintaining the function of bone marrow-derived macrophages and provide new insight into the study and treatment of atherosclerosis
25531779 this study propose that the STRIPAK complex, FAM40A, FAM40B and STRN3, regulates the mode of cancer cell migration by controlling the activity of MST3 and 4, which locally coordinate the phosphorylation of ERM proteins and inhibit the dephosphorylation of MLC leading to increased actin-membrane linkage.
25015106 The structure and protein-binding domains of the SG2NA protein variants have been described.
24550388 This result combined with a number of biophysical analyses provide evidence that the coiled coil domain of striatin 3 and the PP2A A subunit form a stable core complex with a 2:2 stoichiometry
23678272 STRN3 (rs2273171)is associated with single nucleotide polymorphisms in Korean patients, either non-segmental or segmental type.

AA Sequence

MDELAGGGGGGPGMAAPPRQQQGPGGNLGLSPGGNGAAGGGGPPASEGAGPAAGPELSRPQQYTIPGILH      1 - 70
YIQHEWARFEMERAHWEVERAELQARIAFLQGERKGQENLKKDLVRRIKMLEYALKQERAKYHKLKYGTE     71 - 140
LNQGDLKMPTFESEETKDTEAPTAPQNSQLTWKQGRQLLRQYLQEVGYTDTILDVRSQRVRSLLGLSNSE    141 - 210
PNGSVETKNLEQILNGGESPKQKGQEIKRSSGDVLETFNFLENADDSDEDEENDMIEGIPEGKDKHRMNK    211 - 280
HKIGNEGLAADLTDDPDTEEALKEFDFLVTAEDGEGAGEARSSGDGTEWDKDDLSPTAEVWDVDQGLISK    281 - 350
LKEQYKKERKGKKGVKRANRTKLYDMIADLGDDELPHIPSGIINQSRSASTRMTDHEGARAEEAEPITFP    351 - 420
SGGGKSFIMGSDDVLLSVLGLGDLADLTVTNDADYSYDLPANKDAFRKTWNPKYTLRSHFDGVRALAFHP    421 - 490
VEPVLVTASEDHTLKLWNLQKTVPAKKSASLDVEPIYTFRAHIGPVLSLAISSNGEQCFSGGIDATIQWW    491 - 560
NMPSPSVDPYDTYEPNVLAGTLVGHTDAVWGLAYSGIKNQLLSCSADGTVRLWNPQEKLPCICTYNGDKK    561 - 630
HGIPTSVDFIGCDPAHMVTSFNTGSAVIYDLETSQSLVILSSQVDSGLQSNNHINRVVSHPTLPVTITAH    631 - 700
EDRHIKFFDNKTGKMIHSMVAHLDAVTSLAVDPNGIYLMSGSHDCSIRLWNLDSKTCVQEITAHRKKLDE    701 - 770
SIYDVAFHSSKAYIASAGADALAKVFV                                               771 - 797
//

Text Mined References (40)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26022125 2015 SG2NA enhances cancer cell survival by stabilizing DJ-1 and thus activating Akt.
25743393 2015 CCM-3/STRIPAK promotes seamless tube extension through endocytic recycling.
25531779 2015 STRIPAK components determine mode of cancer cell migration and metastasis.
25015106 2014 Molecular modeling and molecular dynamics simulations based structural analysis of the SG2NA protein variants.
24550388 2014 Striatins contain a noncanonical coiled coil that binds protein phosphatase 2A A subunit to form a 2:2 heterotetrameric core of striatin-interacting phosphatase and kinase (STRIPAK) complex.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23678272 2013 Three new single nucleotide polymorphisms identified by a genome-wide association study in Korean patients with vitiligo.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18502210 2008 The armadillo repeat domain of the APC tumor suppressor protein interacts with Striatin family members.
18434427 2008 Striatin-3 gamma inhibits estrogen receptor activity by recruiting a protein phosphatase.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16396496 2006 Insulin-dependent interactions of proteins with GLUT4 revealed through stable isotope labeling by amino acids in cell culture (SILAC).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11570823 2001 Transcription activating property of autoantigen SG2NA and modulating effect of WD-40 repeats.
11319234 2001 A mammalian homolog of yeast MOB1 is both a member and a putative substrate of striatin family-protein phosphatase 2A complexes.
11251078 2001 Molecular cloning and characterization of phocein, a protein found from the Golgi complex to dendritic spines.
10748158 2000 Zinedin, SG2NA, and striatin are calmodulin-binding, WD repeat proteins principally expressed in the brain.
10681496 2000 WD40 repeat proteins striatin and S/G(2) nuclear autoantigen are members of a novel family of calmodulin-binding proteins that associate with protein phosphatase 2A.
7910562 1994 Characterization of a DNA-binding nuclear autoantigen mainly associated with S phase and G2 cells.
7864889 1995 A cell-cycle nuclear autoantigen containing WD-40 motifs expressed mainly in S and G2 phase cells.