Property Summary

NCBI Gene PubMed Count 13
PubMed Score 6.18
PubTator Score 3.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.078 5.6e-05
adult high grade glioma -1.100 3.0e-02
Astrocytoma, Pilocytic -1.400 7.2e-05
atypical teratoid / rhabdoid tumor -2.100 3.8e-03
diabetes mellitus -1.400 4.0e-03
ependymoma -1.500 1.6e-05
glioblastoma -1.200 4.5e-04
group 3 medulloblastoma -1.300 9.3e-03
intraductal papillary-mucinous neoplasm ... 1.500 6.7e-03
medulloblastoma, large-cell -1.900 7.9e-04
pituitary cancer 1.500 2.6e-05
primitive neuroectodermal tumor -1.900 2.5e-03
psoriasis 1.900 5.3e-89
ulcerative colitis 2.500 3.8e-06

Gene RIF (1)

AA Sequence

MEDPAAPGTGGPPANGNGNGGGKGKQAAPKGREAFRSQRRESEGSVDCPTLEFEYGDADGHAAELSELYS      1 - 70
YTENLEFTNNRRCFEEDFKTQVQGKEWLELEEDAQKAYIMGLLDRLEVVSRERRLKVARAVLYLAQGTFG     71 - 140
ECDSEVDVLHWSRYNCFLLYQMGTFSTFLELLHMEIDNSQACSSALRKPAVSIADSTELRVLLSVMYLMV    141 - 210
ENIRLERETDPCGWRTARETFRTELSFSMHNEEPFALLLFSMVTKFCSGLAPHFPIKKVLLLLWKVVMFT    211 - 280
LGGFEHLQTLKVQKRAELGLPPLAEDSIQVVKSMRAASPPSYTLDLGESQLAPPPSKLRGRRGSRRQLLT    281 - 350
KQDSLDIYNERDLFKTEEPATEEEEESAGDGERTLDGELDLLEQDPLVPPPPSQAPLSAERVAFPKGLPW    351 - 420
APKVRQKDIEHFLEMSRNKFIGFTLGQDTDTLVGLPRPIHESVKTLKQHKYISIADVQIKNEEELEKCPM    421 - 490
SLGEEVVPETPCEILYQGMLYSLPQYMIALLKILLAAAPTSKAKTDSINILADVLPEEMPITVLQSMKLG    491 - 560
IDVNRHKEIIVKSISTLLLLLLKHFKLNHIYQFEYVSQHLVFANCIPLILKFFNQNILSYITAKNSISVL    561 - 630
DYPCCTIQDLPELTTESLEAGDNSQFCWRNLFSCINLLRLLNKLTKWKHSRTMMLVVFKSAPILKRALKV    631 - 700
KQAMLQLYVLKLLKLQTKYLGRQWRKSNMKTMSAIYQKVRHRMNDDWAYGNDIDARPWDFQAEECTLRAN    701 - 770
IEAFNSRRYDRPQDSEFSPVDNCLQSVLGQRLDLPEDFHYSYELWLEREVFSQPICWEELLQNH          771 - 834
//

Text Mined References (15)

PMID Year Title