Property Summary

NCBI Gene PubMed Count 20
PubMed Score 66.85
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytic glioma -1.200 3.3e-02
glioblastoma -2.900 4.8e-05
osteosarcoma -3.165 5.5e-06
ependymoma -1.600 6.7e-07
atypical teratoid / rhabdoid tumor -2.100 1.3e-05
medulloblastoma -1.500 1.9e-05
medulloblastoma, large-cell -2.100 2.2e-04
primitive neuroectodermal tumor -1.400 2.8e-03
non-small cell lung cancer 1.274 2.2e-12
intraductal papillary-mucinous adenoma (... 1.800 7.8e-04
intraductal papillary-mucinous carcinoma... 1.900 5.0e-04
intraductal papillary-mucinous neoplasm ... 1.800 7.5e-03
Breast cancer 3.100 3.2e-02
adult high grade glioma -2.700 2.9e-05
pilocytic astrocytoma -2.500 6.1e-08
subependymal giant cell astrocytoma -1.097 4.6e-02
nasopharyngeal carcinoma -1.200 2.6e-03
Endometriosis -1.055 2.2e-02
spina bifida -1.233 3.7e-02
progressive supranuclear palsy 1.200 2.9e-02
ductal carcinoma in situ 1.300 1.7e-03
invasive ductal carcinoma 1.700 7.7e-03
ovarian cancer -2.100 1.2e-05
pituitary cancer -1.300 1.4e-03

Pathway (1)

Gene RIF (1)

PMID Text
22391137 Low STRBP mRNA is associated with cryptorchidism and Down's syndrome.

AA Sequence

MRSIRSFANDDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEGETEVKKDEAG      1 - 70
ENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLTEEKYQVE     71 - 140
QCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLLDRQKCLNALASLRHAKWFQA    141 - 210
RANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGG    211 - 280
PGLHDPCERDPTDALSYMTIQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGA    281 - 350
GSSALKRPFEDGLGDDKDPNKKMKRNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTM    351 - 420
SVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSSNNTGNS    421 - 490
TTETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRGAGPNKK    491 - 560
VAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAVSAAVQAVRGRGRGTLTRGAFVGATAAPGYI    561 - 630
APGYGTPYGYSTAAPAYGLPKRMVLLPVMKFPTYPVPHYSFF                                631 - 672
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22391137 2012 Expression of STRBP mRNA in patients with cryptorchidism and Down's syndrome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16381901 2006 The LIFEdb database in 2006.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11336498 2001 Mice deficient for spermatid perinuclear RNA-binding protein show neurologic, spermatogenic, and sperm morphological abnormalities.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10684936 2000 A new double-stranded RNA-binding protein that interacts with PKR.
9674995 1998 Spermatid perinuclear ribonucleic acid-binding protein binds microtubules in vitro and associates with abnormal manchettes in vivo in mice.
7744952 1995 Spnr, a murine RNA-binding protein that is localized to cytoplasmic microtubules.
7519613 1994 Cloning and expression of cyclosporin A- and FK506-sensitive nuclear factor of activated T-cells: NF45 and NF90.