Property Summary

NCBI Gene PubMed Count 37
PubMed Score 20.58
PubTator Score 638.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Colorectal Neoplasms 217
Disease Target Count P-value
osteosarcoma 7933 6.8e-06
lung cancer 4473 1.1e-04
astrocytic glioma 2241 1.2e-02
ovarian cancer 8491 1.5e-02
Multiple myeloma 1327 1.8e-02
oligodendroglioma 2849 2.2e-02
ependymoma 2514 3.2e-02
Disease Target Count Z-score Confidence
Muscular atrophy 67 4.467 2.2
Spinal muscular atrophy 24 3.574 1.8

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.180 1.8e-02
astrocytic glioma -1.400 1.2e-02
ependymoma -1.300 3.2e-02
oligodendroglioma -1.200 2.2e-02
osteosarcoma -1.267 6.8e-06
lung cancer 1.400 1.1e-04
ovarian cancer 1.500 1.5e-02

 GO Function (1)

Gene RIF (19)

PMID Text
26373288 MAWD and MAWBP were downregulated and associated with the differentiation grade in GC tissues.
25483064 STRAP inhibits the transactivation function of Sp1 either by directly blocking its DNA binding domain or destabilizing Sp1 protein through ubiquitin-proteasome pathway in cell cycle G1 phase.
25168243 Strap augments the apoptotic effects of mitochondrial p53.
23918805 Data indicate serine-threonine kinase receptor-associated protein (STRAP) as a novel regulator of the coordinated translation of collagen alpha1(I) and alpha2(I) mRNAs.
23687415 Coexpression of MAWBP and MAWD inhibited epithelial mesenchymal transformation, and EMT-aided malignant cell progression was suppressed in gastric cancer.
22362889 both of the TPR and OB-fold domains localize to the chromatin of p53 target genes and exhibit intrinsic regulatory activity necessary for the Strap-dependent p53 response
22190034 HIV-1 NC is identified to have a physical interaction with serine/threonine kinase receptor associated protein (STRAP) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21502811 STRAP protein decreases ubiquitination of intracellular domain of Notch3 and may help to stabilize it.
21148321 B-MYB acts as a positive regulator of STRAP
20144149 gonucleotide pulldown identified STRAP (serine/threonine kinase receptor-associated protein) as a further protein recruited to the MMP28 promoter and acting functionally with Sp1.
19880523 STRAP can act as a negative regulator of ASK1.
18833288 Strap regulation reflects the coordinated interplay between different DNA damage-activated protein kinases, ATM and Chk2 (Checkpoint kinase 2), where phosphorylation by each kinase provides a distinct functional consequence on the activity of Strap.
17984321 an interplay between PPM1G and unrip determine compartment-specific phosphorylation patterns, localization, and function of the SMN complex
17316412 These results indicate that upregulation of STRAP might play a role in tumor development as an early event for colorectal cancers.
17314099 the direct interaction of NM23-H1 and STRAP is important for the regulation of TGF-beta-dependent biological activity as well as NM23-H1 activity
17023415 Gemin8 has an essential role in the proper structural organization of the SMN complex and the involvement of the heteromeric subunit containing Gemin6, Gemin7, Gemin8, and Unrip in the recruitment of Sm proteins to the snRNP assembly pathway
16251192 STRAP acts as an intermediate signaling molecule linking between the phosphatidylinositol 3-kinase/PDK1 and the TGF-beta signaling pathways
16159890 biochemical evidence for the existence of another, yet atypical, SMN complex component, termed unr-interacting protein (unrip)
15848170 unrip functions in the pathway of small nuclear ribonucleoproteins biogenesis

AA Sequence

MAMRQTPLTCSGHTRPVVDLAFSGITPYGYFLISACKDGKPMLRQGDTGDWIGTFLGHKGAVWGATLNKD      1 - 70
ATKAATAAADFTAKVWDAVSGDELMTLAHKHIVKTVDFTQDSNYLLTGGQDKLLRIYDLNKPEAEPKEIS     71 - 140
GHTSGIKKALWCSEDKQILSADDKTVRLWDHATMTEVKSLNFNMSVSSMEYIPEGEILVITYGRSIAFHS    141 - 210
AVSLDPIKSFEAPATINSASLHPEKEFLVAGGEDFKLYKYDYNSGEELESYKGHFGPIHCVRFSPDGELY    211 - 280
ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEELEEIASENSDCIFPSAPDVKA    281 - 350
//

Text Mined References (43)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26373288 2015 Mitogen-activated protein kinase activator with WD40 repeats (MAWD) and MAWD-binding protein induce cell differentiation in gastric cancer.
25483064 2014 Oncogenic STRAP functions as a novel negative regulator of E-cadherin and p21(Cip1) by modulating the transcription factor Sp1.
25168243 2015 Cofactor Strap regulates oxidative phosphorylation and mitochondrial p53 activity through ATP synthase.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23918805 2013 Serine-threonine kinase receptor-associated protein (STRAP) regulates translation of type I collagen mRNAs.
23687415 2013 MAWBP and MAWD inhibit proliferation and invasion in gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22362889 2012 The p53 cofactor Strap exhibits an unexpected TPR motif and oligonucleotide-binding (OB)-fold structure.
21502811 2011 Role of STRAP in regulating GSK3? function and Notch3 stabilization.
21269460 2011 Initial characterization of the human central proteome.
21148321 2011 B-MYB positively regulates serine-threonine kinase receptor-associated protein (STRAP) activity through direct interaction.
20144149 2010 MMP28 gene expression is regulated by Sp1 transcription factor acetylation.
19880523 2010 Serine-threonine kinase receptor-associated protein inhibits apoptosis signal-regulating kinase 1 function through direct interaction.
18984161 2008 An assembly chaperone collaborates with the SMN complex to generate spliceosomal SnRNPs.
18833288 2008 ATM and Chk2 kinase target the p53 cofactor Strap.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984321 2007 Dephosphorylation of survival motor neurons (SMN) by PPM1G/PP2Cgamma governs Cajal body localization and stability of the SMN complex.
17929853 2007 Comparative analysis of the protein profiles from primary gastric tumors and their adjacent regions: MAWBP could be a new protein candidate involved in gastric cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17316412 2007 Overexpression of serine-threonine receptor kinase-associated protein in colorectal cancers.
17314099 2007 NM23-H1 tumor suppressor physically interacts with serine-threonine kinase receptor-associated protein, a transforming growth factor-beta (TGF-beta) receptor-interacting protein, and negatively regulates TGF-beta signaling.
17023415 2006 Gemin8 is required for the architecture and function of the survival motor neuron complex.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16251192 2005 Regulation of transforming growth factor-beta signaling and PDK1 kinase activity by physical interaction between PDK1 and serine-threonine kinase receptor-associated protein.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16159890 2005 Unrip, a factor implicated in cap-independent translation, associates with the cytosolic SMN complex and influences its intracellular localization.
15848170 2005 Unrip is a component of SMN complexes active in snRNP assembly.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11355021 2001 Cloning and sequencing of a novel human gene which encodes a putative hydroxylase.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10757800 2000 STRAP and Smad7 synergize in the inhibition of transforming growth factor beta signaling.
10646843 2000 Molecular cloning and characterization of human MAWD, a novel protein containing WD-40 repeats frequently overexpressed in breast cancer.
10049359 1999 unr, a cellular cytoplasmic RNA-binding protein with five cold-shock domains, is required for internal initiation of translation of human rhinovirus RNA.
9856985 1998 Identification of STRAP, a novel WD domain protein in transforming growth factor-beta signaling.