Property Summary

NCBI Gene PubMed Count 15
PubMed Score 11.50
PubTator Score 6.46

Knowledge Summary

Patent (2,043)

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

Protein-protein Interaction (9)

Gene RIF (1)

AA Sequence

MSLLDCFCTSRTQVESLRPEKQSETSIHQYLVDEPTLSWSRPSTRASEVLCSTNVSHYELQVEIGRGFDN      1 - 70
LTSVHLARHTPTGTLVTIKITNLENCNEERLKALQKAVILSHFFRHPNITTYWTVFTVGSWLWVISPFMA     71 - 140
YGSASQLLRTYFPEGMSETLIRNILFGAVRGLNYLHQNGCIHRSIKASHILISGDGLVTLSGLSHLHSLV    141 - 210
KHGQRHRAVYDFPQFSTSVQPWLSPELLRQDLHGYNVKSDIYSVGITACELASGQVPFQDMHRTQMLLQK    211 - 280
LKGPPYSPLDISIFPQSESRMKNSQSGVDSGIGESVLVSSGTHTVNSDRLHTPSSKTFSPAFFSLVQLCL    281 - 350
QQDPEKRPSASSLLSHVFFKQMKEESQDSILSLLPPAYNKPSISLPPVLPWTEPECDFPDEKDSYWEF      351 - 418
//

Text Mined References (16)

PMID Year Title