Property Summary

NCBI Gene PubMed Count 25
PubMed Score 23.34
PubTator Score 20.45

Knowledge Summary

Patent (3,680)

TINX Plot

  Disease (4)

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.423 2.2e-06

Gene RIF (9)

PMID Text
20424326 aberrant nuclear accumulation of LKB1 caused by STRADalpha deficiency contributes to hyperactivation of mTORC1 signaling and disruption of neuronal lamination during corticogenesis
19892943 study describes structure of the core heterotrimeric LKB1-STRADalpha-MO25alpha complex, revealing an unusual allosteric mechanism of LKB1 activation; structure also reveals how mutations in Peutz-Jeghers syndrome & sporadic cancers impair LKB1 function
19513107 ATP and MO25alpha cooperate to maintain STRADalpha in an "active" closed conformation required for LKB1 activation.
19386264 These data define a brush border induction pathway downstream of the Lkb1/Strad/Mo25 polarization complex, yet separate from other polarity events.
18854318 STRADalpha.MO25alpha complexes containing LKB1 variants were equally effective at phosphorylating and activating AMPK, BRSK1, and BRSK2
18687677 LKB1 deacetylation is regulated by SIRT1 and that this in turn influences its intracellular localization, association with STRAD, kinase activity, and ability to activate AMPK.
18256292 identify a multifactored mechanism to control LKB1 localization, and they suggest that the STRADbeta-LKB1 complex might possess unique functions in the nucleus
17921699 Several novel splice isoforms of STRADalpha that differentially affect the kinase activity, complex assembly, subcellular localization of LKB1 and the activation of the LKB1-dependent AMPK pathway were discovered.
12805220 Identification and characterization of an LKB1-specific adaptor protein and substrate, STRAD. Results imply that STRAD plays a key role in regulating the tumor suppressor activities of LKB1.

AA Sequence

MSFLVSKPERIRRWVSEKFIVEGLRDLELFGEQPPGDTRRKTNDASSESIASFSKQEVMSSFLPEGGCYE      1 - 70
LLTVIGKGFEDLMTVNLARYKPTGEYVTVRRINLEACSNEMVTFLQGELHVSKLFNHPNIVPYRATFIAD     71 - 140
NELWVVTSFMAYGSAKDLICTHFMDGMNELAIAYILQGVLKALDYIHHMGYVHRSVKASHILISVDGKVY    141 - 210
LSGLRSNLSMISHGQRQRVVHDFPKYSVKVLPWLSPEVLQQNLQGYDAKSDIYSVGITACELANGHVPFK    211 - 280
DMPATQMLLEKLNGTVPCLLDTSTIPAEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSP    281 - 350
HFHHFVEQCLQRNPDARPSASTLLNHSFFKQIKRRASEALPELLRPVTPITNFEGSQSQDHSGIFGLVTN    351 - 420
LEELEVDDWEF                                                               421 - 431
//

Text Mined References (31)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21423148 2011 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
20562859 2010 Network organization of the human autophagy system.
20424326 2010 STRADalpha deficiency results in aberrant mTORC1 signaling during corticogenesis in humans and mice.
19892943 2009 Structure of the LKB1-STRAD-MO25 complex reveals an allosteric mechanism of kinase activation.
19513107 2009 ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor.
19386264 2009 Mst4 and Ezrin induce brush borders downstream of the Lkb1/Strad/Mo25 polarization complex.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18854318 2009 C-terminal phosphorylation of LKB1 is not required for regulation of AMP-activated protein kinase, BRSK1, BRSK2, or cell cycle arrest.
18687677 2008 SIRT1 modulation of the acetylation status, cytosolic localization, and activity of LKB1. Possible role in AMP-activated protein kinase activation.
18391951 2008 Many sequence variants affecting diversity of adult human height.
18256292 2008 STRADalpha regulates LKB1 localization by blocking access to importin-alpha, and by association with Crm1 and exportin-7.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17921699 2007 Novel splice isoforms of STRADalpha differentially affect LKB1 activity, complex assembly and subcellular localization.
17522105 2007 Polyhydramnios, megalencephaly and symptomatic epilepsy caused by a homozygous 7-kilobase deletion in LYK5.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16054041 2005 AMP-activated protein kinase: ancient energy gauge provides clues to modern understanding of metabolism.
15733851 2005 Identification of the sucrose non-fermenting related kinase SNRK, as a novel LKB1 substrate.
15561763 2004 Analysis of the LKB1-STRAD-MO25 complex.
15183188 2004 LKB1 tumor suppressor protein: PARtaker in cell polarity.
14976552 2004 LKB1 is a master kinase that activates 13 kinases of the AMPK subfamily, including MARK/PAR-1.
14730349 2004 Crystal structure of MO25 alpha in complex with the C terminus of the pseudo kinase STE20-related adaptor.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676191 2004 Comprehensive proteomic analysis of human Par protein complexes reveals an interconnected protein network.
14517248 2003 MO25alpha/beta interact with STRADalpha/beta enhancing their ability to bind, activate and localize LKB1 in the cytoplasm.
12805220 2003 Activation of the tumour suppressor kinase LKB1 by the STE20-like pseudokinase STRAD.
12747765 2001 Humoral immunity to human breast cancer: antigen definition and quantitative analysis of mRNA expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.