Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.11
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Rubinstein-Taybi syndrome 10 4.43 2.2
Syndactyly 88 3.786 1.9

Expression

AA Sequence

MMNSDQKAVKFLANFYINGGKHWTHGHLRQTQPEPTQPKASVLLLGPEPGMAWDETQPPKMKEIPVGLRL      1 - 70
QTGTPQESLPTYTQTLRELLLEQRPLITADLEVPSPTRYQVPSPSVRESSPHPHYSIGCKHQGREGGGRR     71 - 140
AWQTLWFQSESPFTQKADFDQEQKWPSPAHYQLLSRPAFPAFSFRGCHSASKTPEGHTHLGLPGARGLGL    141 - 210
RVQPQSLLQASLQAPGKRCPGPNTYNILPGSRLQSPRSPAFSMSRSPAFTSWLSTWLPAFSFGSPNPWPS    211 - 280
RLPRGGLQLTLPFGAWRGHPGCTQTQAPRHRPLLHALEPAGHNLLGPATEWNHGLPRGFPRPPLGLGAPA    281 - 350
WPSDPLGTPMHPSGWPTLLWAVDKAGPAWIPHLPISPLH                                   351 - 389
//

Text Mined References (4)

PMID Year Title