Property Summary

NCBI Gene PubMed Count 23
PubMed Score 18.26
PubTator Score 23.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
oligodendroglioma -1.200 1.0e-02
group 3 medulloblastoma -2.400 4.4e-04
glioblastoma -1.400 6.7e-03
medulloblastoma, large-cell -2.000 1.7e-04
primitive neuroectodermal tumor -1.200 1.5e-02
adrenocortical carcinoma -1.137 7.1e-07
adult high grade glioma -1.700 2.6e-05
pilocytic astrocytoma -1.800 2.3e-05
lung carcinoma 2.100 3.7e-08
ductal carcinoma in situ -1.300 1.4e-04
invasive ductal carcinoma -1.500 4.3e-03
chronic rhinosinusitis -1.287 2.7e-02

Gene RIF (14)

PMID Text
22995177 A STOX1A-dependent effect on tau phosphorylation found in neurodegenerative diseases such as Alzheimer's disease.
22728895 Transcription factor STOX1A and its target gene, CNTNAP2, are potentially involved in the etiology of Alzheimer's disease.
22253775 Mitotic entry is enhanced through the direct upregulation of cyclin B1 expression effectuated by STOX1A.
21755018 Upregulation of total tau expression (SFRS7-independent) and tau exon 10 splicing (SFRS7-dependent), as shown in this study to be both affected by STOX1A, is known to have implications in neurodegeneration.
21490791 STOX1 is one of the genes that give susceptibility for preeclampsia.
20716964 methylation is independent of parental origin, but regulates STOX1 expression with the Y153H genotype directing the level of methylation.
20643876 STOX1 does not show differential expression in deciduas from pregnancies complicated by both pre-eclampsia and FGR as compared with controls.
20400461 The risk allele (Y153H) of the preeclampsia susceptibility gene STOX1 negatively regulates trophoblast invasion by upregulation of the cell-cell adhesion protein a-T-catenin (CTNNA3).
20110611 The data of this study indicated that STOX1 controls a conserved pathway shared between placenta and brain with overexpression in late-onset Alzheimer's disease.
19577309 role in placental development and preeclampsia (Review)
19079545 Anomalies in STOX1 expression are associated with the onset of preeclampsia.
17617193 Observational study of gene-disease association. (HuGE Navigator)
17290274 Observational study of gene-disease association. (HuGE Navigator)
17290274 In conclusion, we are unable to validate STOX1 as a common preeclampsia susceptibility gene.

AA Sequence

MARPVQLAPGSLALVLCRLEAQKAAGAAEEPGGRAVFRAFRRANARCFWNARLARAASRLAFQGWLRRGV      1 - 70
LLVRAPPACLQVLRDAWRRRALRPPRGFRIRAVGDVFPVQMNPITQSQFVPLGEVLCCAISDMNTAQIVV     71 - 140
TQESLLERLMKHYPGIAIPSEDILYTTLGTLIKERKIYHTGEGYFIVTPQTYFITNTTTQENKRMLPSDE    141 - 210
SRLMPASMTYLVSMESCAESAQENAAPISHCQSCQCFRDMHTQDVQEAPVAAEVTRKSHRGLGESVSWVQ    211 - 280
NGAVSVSAEHHICESTKPLPYTRDKEKGKKFGFSLLWRSLSRKEKPKTEHSSFSAQFPPEEWPVRDEDDL    281 - 350
DNIPRDVEHEIIKRINPILTVDNLIKHTVLMQKYEEQKKYNSQGTSTDMLTIGHKYPSKEGVKKRQGLSA    351 - 420
KPQGQGHSRRDRHKARNQGSEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYK    421 - 490
KRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEKPFQKPRSLDSSRIFDGKAKEPYAEQPNDKME    491 - 560
AESIYINDPTVKPINDDFRGHLFSHPQQSMLQNDGKCCPFMESMLRYEVYGGENEVIPEVLRKSHSHFDK    561 - 630
LGETKQTPHSLPSRGASFSDRTPSACRLVDNTIHQFQNLGLLDYPVGVNPLRQAARQDKDSEELLRKGFV    631 - 700
QDAETTSLENEQLSNDDQALYQNEVEDDDGACSSLYLEEDDISENDDLRQMLPGHSQYSFTGGSQGNHLG    701 - 770
KQKVIERSLTEYNSTMERVESQVLKRNECYKPTGLHATPGESQEPNLSAESCGLNSGAQFGFNYEEEPSV    771 - 840
AKCVQASAPADERIFDYYSARKASFEAEVIQDTIGDTGKKPASWSQSPQNQEMRKHFPQKFQLFNTSHMP    841 - 910
VLAQDVQYEHSHLEGTENHSMAGDSGIDSPRTQSLGSNNSVILDGLKRRQNFLQNVEGTKSSQPLTSNSL    911 - 980
LPLTPVINV                                                                 981 - 989
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24738702 2014 Nitroso-redox balance and mitochondrial homeostasis are regulated by STOX1, a pre-eclampsia-associated gene.
22995177 2012 STOX1A induces phosphorylation of tau proteins at epitopes hyperphosphorylated in Alzheimer's disease.
22993228 2013 Novel genetic variants associated with lumbar disc degeneration in northern Europeans: a meta-analysis of 4600 subjects.
22728895 2012 Direct downregulation of CNTNAP2 by STOX1A is associated with Alzheimer's disease.
22253775 2012 Transcription factor STOX1A promotes mitotic entry by binding to the CCNB1 promotor.
21755018 2011 SFRS7-mediated splicing of tau exon 10 is directly regulated by STOX1A in glial cells.
21490791 2011 STOX1: Key player in trophoblast dysfunction underlying early onset preeclampsia with growth retardation.
20716964 Differential methylation of STOX1 in human placenta.
20643876 2010 STOX2 but not STOX1 is differentially expressed in decidua from pre-eclamptic women: data from the Second Nord-Trondelag Health Study.
20400461 2010 The STOX1 genotype associated with pre-eclampsia leads to a reduction of trophoblast invasion by alpha-T-catenin upregulation.
20110611 2010 The pre-eclampsia gene STOX1 controls a conserved pathway in placenta and brain upregulated in late-onset Alzheimer's disease.
19577309 2009 Re-evaluation of the role of STOX1 transcription factor in placental development and preeclampsia.
19079545 2008 STOX1 overexpression in choriocarcinoma cells mimics transcriptional alterations observed in preeclamptic placentas.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17617193 2007 STOX1 gene in pre-eclampsia and intrauterine growth restriction.
17290274 2007 Evaluation of STOX1 as a preeclampsia candidate gene in a population-wide sample.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15806103 2005 Maternal segregation of the Dutch preeclampsia locus at 10q22 with a new member of the winged helix gene family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.