Property Summary

NCBI Gene PubMed Count 18
PubMed Score 28.94
PubTator Score 15.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
osteosarcoma 1.587 2.1e-03
group 3 medulloblastoma -2.000 1.8e-02
atypical teratoid / rhabdoid tumor -1.900 3.2e-04
medulloblastoma, large-cell -1.900 1.6e-02
tuberculosis 1.500 3.7e-05
intraductal papillary-mucinous neoplasm ... 1.700 1.5e-02
interstitial cystitis -1.600 3.6e-03
pilocytic astrocytoma -1.400 3.2e-03
posterior fossa group B ependymoma 1.100 1.1e-03
subependymal giant cell astrocytoma 1.827 4.0e-02
Pick disease 1.300 1.3e-02
ulcerative colitis -1.200 3.0e-07
ovarian cancer 2.000 1.3e-04
pituitary cancer 1.100 5.5e-05

 GWAS Trait (1)

Gene RIF (4)

PMID Text
23785397 The present study demonstrated that the functional variant of the STON2 gene could alter cortical surface area on the right inferior temporal and contribute to the pathogenesis of schizophrenia.
21407139 STON2 may be a susceptibility gene for Chinese Han patients with schizophrenia.
18166656 Our data identify the molecular determinants for recognition of synaptotagmin by stonin 2 or its Caenorhabditis elegans orthologue UNC-41B.
16459302 The ability of stonin 2 to facilitate endocytosis of synaptotagmin is dependent on its association with AP-2, an intact mu-homology domain, and functional AP-2 heterotetramers.

AA Sequence

MTTLDHVIATHQSEWVSFNEEPPFPAHSQGGTEEHLPGLSSSPDQSESSSGENHVVDGGSQDHSHSEQDD      1 - 70
SSEKMGLISEAASPPGSPEQPPPDLASAISNWVQFEDDTPWASTSPPHQETAETALPLTMPCWTCPSFDS     71 - 140
LGRCPLTSESSWTTHSEDTSSPSFGCSYTDLQLINAEEQTSGQASGADSTDNSSSLQEDEEVEMEAISWQ    141 - 210
ASSPAMNGHPAPPVTSARFPSWVTFDDNEVSCPLPPVTSPLKPNTPPSASVIPDVPYNSMGSFKKRDRPK    211 - 280
STLMNFSKVQKLDISSLNRTPSVTEASPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISST    281 - 350
TGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSA    351 - 420
RSQPRDGWPMMLRIPEKKNIMSSRHWGPIFVKLTDTGYLQLYYEQGLEKPFREFKLEICHEISEPRLQNY    421 - 490
DENGRIHSLRIDRVTYKEKKKYQPKPAVAHTAEREQVIKLGTTNYDDFLSFIHAVQDRLMDLPVLSMDLS    491 - 560
TVGLNYLEEEITVDVRDEFSGIVSKGDNQILQHHVLTRIHILSFLSGLAECRLGLNDILVKGNEIVLRQD    561 - 630
IMPTTTTKWIKLHECRFHGCVDEDVFHNSRVILFNPLDACRFELMRFRTVFAEKTLPFTLRTATSVNGAE    631 - 700
VEVQSWLRMSTGFSANRDPLTQVPCENVMIRYPVPSEWVKNFRRESVLGEKSLKAKVNRGASFGSTSVSG    701 - 770
SEPVMRVTLGTAKYEHAFNSIVWRINRLPDKNSASGHPHCFFCHLELGSDREVPSRFANHVNVEFSMPTT    771 - 840
SASKASVRSISVEDKTDVRKWVNYSAHYSYQVALGSIWLMLPTPFVHPTTLPLLFLLAMLTMFAW         841 - 905
//

Text Mined References (20)

PMID Year Title
23785397 2013 Cortical surface area correlates with STON2 gene Ser307Pro polymorphism in first-episode treatment-naïve patients with schizophrenia.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21407139 2011 Positive association of the human STON2 gene with schizophrenia.
21269460 2011 Initial characterization of the human central proteome.
21102408 2011 CSN complex controls the stability of selected synaptic proteins via a torsinA-dependent process.
19732400 2010 Stonins--specialized adaptors for synaptic vesicle recycling and beyond?
19636924 2008 1H, 13C, and 15N chemical shift assignments for the Eps15-EH2-stonin 2 complex.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
18200045 2008 Structure of the Eps15-stonin2 complex provides a molecular explanation for EH-domain ligand specificity.
18166656 2007 Molecular basis of synaptic vesicle cargo recognition by the endocytic sorting adaptor stonin 2.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16459302 2006 Stonin 2 is an AP-2-dependent endocytic sorting adaptor for synaptotagmin internalization and recycling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14726597 2004 Functional dissection of the interactions of stonin 2 with the adaptor complex AP-2 and synaptotagmin.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11454741 2001 Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.
11381094 2001 Stonin 2: an adaptor-like protein that interacts with components of the endocytic machinery.