Property Summary

NCBI Gene PubMed Count 10
PubMed Score 21.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
urothelial carcinoma -2.500 1.7e-02
malignant mesothelioma -1.700 7.5e-07
astrocytic glioma 3.400 1.2e-03
ependymoma 3.800 3.3e-03
oligodendroglioma 3.000 5.3e-03
psoriasis -1.200 1.0e-05
cutaneous lupus erythematosus -1.300 3.9e-03
glioblastoma 2.400 9.9e-04
osteosarcoma 1.588 1.9e-03
atypical teratoid / rhabdoid tumor 2.100 4.7e-04
primitive neuroectodermal tumor 2.200 1.4e-02
adrenocortical carcinoma -1.709 4.0e-07
intraductal papillary-mucinous adenoma (... -2.100 1.2e-03
intraductal papillary-mucinous carcinoma... -2.100 9.4e-04
intraductal papillary-mucinous neoplasm ... -2.100 1.2e-02
lung cancer -1.800 4.1e-03
colon cancer -2.600 4.0e-04
interstitial cystitis -1.100 2.7e-02
pediatric high grade glioma 1.900 1.9e-03
pilocytic astrocytoma 2.400 3.4e-05
acute myeloid leukemia -1.200 1.7e-02
lung adenocarcinoma -1.300 2.4e-10
lung carcinoma -1.400 9.1e-09
gastric carcinoma 1.600 2.6e-02
invasive ductal carcinoma -1.500 7.9e-03
ovarian cancer -1.400 3.1e-03

AA Sequence

MCSTNPGKWVTFDDDPAVQSSQKSKNFPLENQGVCRPNGLKLNLPGLREFPSGSSSTSSTPLSSPIVDFY      1 - 70
FSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSDSPLAISGGESSLLPTRPTCLSHALLPSDH     71 - 140
SCTHPTPKVGLPDEVNPQQAESLGFQSDDLPQFQYFREDCAFSSPFWKDEGSDSHFTLDPPGSKKMFSSR    141 - 210
NKEMPIDQKSLNKCSLNYICEKLEHLQSAENQDSLRSLSMHCLCAEENASSFVPHTLFRSQPKSGWSFML    211 - 280
RIPEKKNMMSSRQWGPIFLKVLPGGILQMYYEQGLEKPFKEIQLDPYCRLSEPKVENFSVAGKIHTVKIE    281 - 350
HVSYTEKRKYHSKTEVVHEPDIEQMLKLGSTSYHDFLDFLTTVEEELMKLPAVSKPKKNYEEQEISLEIV    351 - 420
DNFWGKVTKEGKFVESAVITQIYCLCFVNGNLECFLTLNDLELPKRDESYYEKDSEKKGIDILDYHFHKC    421 - 490
VNVQEFEQSRIIKFVPLDACRFELMRFKTLYNGDNLPFSLKSVVVVQGAYVELQAFVNMASLAQRSSYAG    491 - 560
SLRSCDNIRIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACLGSLQELESEPVIQVTVGSAKYESAYQA    561 - 630
VVWKIDRLPDKNSSLDHPHCLSYKLELGSDQEIPSDWYPFATVQFSVPDTCASRTEVRSLGVESDVQPQK    631 - 700
HVQQRACYNIQVEIEKKWIKIDGEDPDKIGDCITQ                                       701 - 735
//

Text Mined References (13)

PMID Year Title
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
22885925 2012 Genome-wide association study identifies eight new risk loci for polycystic ovary syndrome.
21151128 2011 Genome-wide association study identifies susceptibility loci for polycystic ovary syndrome on chromosome 2p16.3, 2p21 and 9q33.3.
20967262 2010 Expression of conjoined genes: another mechanism for gene regulation in eukaryotes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11454741 2001 Human stoned B interacts with AP-2 and synaptotagmin and facilitates clathrin-coated vesicle uncoating.
11381094 2001 Stonin 2: an adaptor-like protein that interacts with components of the endocytic machinery.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11159353 2001 TFIIAalpha/beta-like factor is encoded by a germ cell-specific gene whose expression is up-regulated with other general transcription factors during spermatogenesis in the mouse.
10364255 1999 Identification of a general transcription factor TFIIAalpha/beta homolog selectively expressed in testis.