Property Summary

NCBI Gene PubMed Count 43
PubMed Score 9.04
PubTator Score 50.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Dermatitis, Contact 71 0.0 0.0
Disease Target Count
Contact Dermatitis 81
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Acromesomelic dysplasia 10 4.01 2.0

Expression

  Differential Expression (6)

Disease log2 FC p
diabetes mellitus -1.100 1.1e-03
lung cancer 1.900 2.5e-04
Multiple myeloma 1.316 2.1e-03
non primary Sjogren syndrome sicca 1.500 2.3e-02
ovarian cancer 1.200 5.0e-03
pancreatic ductal adenocarcinoma liver m... -1.697 8.8e-03

Gene RIF (33)

AA Sequence

MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVL      1 - 70
DRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK     71 - 140
LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGT    141 - 210
RESAINVAEGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAE    211 - 280
QYVSAFSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEEL    281 - 350
DRVKMS                                                                    351 - 356
//

Text Mined References (52)

PMID Year Title