Property Summary

NCBI Gene PubMed Count 40
PubMed Score 8.30
PubTator Score 50.78

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.316 2.1e-03
pancreatic ductal adenocarcinoma liver m... -1.697 8.8e-03
lung cancer 1.900 2.5e-04
diabetes mellitus -1.100 1.1e-03
non primary Sjogren syndrome sicca 1.500 2.3e-02
ovarian cancer 1.200 5.0e-03

Gene RIF (30)

PMID Text
26750533 The significant association of SLP-2 overexpression with unfavorable clinicopathological characteristics and BRAFV600E mutation indicates that SLP-2 may have a role in aggressiveness of BRAF-mutated papillary thyroid carcinoma.
26487491 Stomatin-like protein 2 is overexpressed in epithelial ovarian cancer and predicts poor patient survival
25973071 STOML2 was correlated to progression in cervical cancer, and implicated it as a potential predictive factor for the prognosis of cervical cancer.
25695396 Our study showed that STOML-2 was negatively regulated by miR1207-5p in esophageal carcinoma
24258357 STOML2 may have a role in progression of gastric adenocarcinoma
24190591 SLP-2 was upregulated by TGF-beta1, indicating a possible role of SLP-2 in Papillary thyroid cancer tumorigenesis.
23918306 SLP-2 may play an important role in human GBC tumorigenesis, and SLP-2 might serve as a novel prognostic marker in human GBC.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of stomatin (EPB72)-like 2 (STOML2) expression by HIV-1 Vpr in Vpr transduced macrophages
23667687 Expression of SLP-2 is associated with invasion of esophageal squamous cell carcinoma.
23371255 Increased levels of SLP-2 correlate with lymph node metastasis in gastric cancer.
23028053 SLP-2 deficiency in T-lymphocytes is associated with abnormal cardiolipin compartmentalization in mitochondrial membranes, defects associated with altered mitochondrial respiration that is increasingly uncoupled from ATP production.
22623988 SLP-2 facilitates the compartmentalization not only of mitochondrial membranes but also of the plasma membrane into functional microdomains.
22190034 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of stomatin (EPB72)-like 2 (STOML2) expression by HIV-1 Vpr in Vpr transduced macrophages
22158085 investigation of biomarkers for early diagnosis of endometriosis: Data suggest that SLP2, tropomyosin 3, and tropomodulin 3 are autoantigens present in blood of women with endometriosis; immunodominant epitopes were identified.
22081131 SLP-2 and HER2/neu can play a role in lymph node/distant metastases of breast cancers
21746876 We propose that the function of SLP-2 is to recruit prohibitins to cardiolipin to form cardiolipin-enriched microdomains in which electron transport complexes are optimally assembled.
21501885 [review] Stomatin family member STOML2 is oligomeric; it localizes mostly to membrane domains and has been shown to modulate ion channel activity.
21220746 The dominant inheritance of hyperphosphorylated paratarg-7 explains cases of familial IgM monoclonal gammopathy of undetermined significance and Waldenstrom macroglobulinemia
21209152 plasma concentrations of stomatin (EPB72)-like 2 in early-stage colorectal cancer patients were elevated as compared with those of healthy individuals
20877624 Observational study of gene-disease association. (HuGE Navigator)
19944461 negatively modulates mitochondrial sodium-calcium exchange
19839737 SLP-2 overexpression is associated with tumour distant metastasis and poor prognosis in pulmonary squamous cell carcinoma.
19767238 Familial MGUS and multiple myeloma were associated with a dominant inheritance of hyperphosphorylated paratarg-7
18641330 SLP-2 is an important player in T cell activation by ensuring sustained TCR signaling
18267007 Endosymbiotic origin of paraslipin from an alphaprotoebacterial ancestor (SLP-2)
17709317 High-level SLP-2 expression was associated with decreased overall survival (P = .011) and was more often found in patients with tumors larger than 20 mm, lymph node metastasis, advanced clinical stage, distant metastasis
17676665 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies downregulation of stomatin (EPB72)-like 2 (STOML2) expression by HIV-1 Vpr in Vpr transduced macrophages
17342323 SLP-2 was overexpressed in endometrial adenocarcinoma compared with their normal counterparts.
16671055 SLP-2 is a high abundance protein in several tissues and cells and may play an important biological role; this study uses mass spectrometry to analyze its primary structure
16533792 overexpression of stomatin-like protein 2 is associated with neoplasms

AA Sequence

MLARAARGTGALLLRGSLLASGRAPRRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILEPGLNILIPVL      1 - 70
DRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVEDPEYAVTQLAQTTMRSELGK     71 - 140
LSLDKVFRERESLNASIVDAINQAADCWGIRCLRYEIKDIHVPPRVKESMQMQVEAERRKRATVLESEGT    141 - 210
RESAINVAEGKKQAQILASEAEKAEQINQAAGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAE    211 - 280
QYVSAFSKLAKDSNTILLPSNPGDVTSMVAQAMGVYGALTKAPVPGTPDSLSSGSSRDVQGTDASLDEEL    281 - 350
DRVKMS                                                                    351 - 356
//

Text Mined References (49)

PMID Year Title
26750533 2016 Stomatin-like protein 2 overexpression in papillary thyroid carcinoma is significantly associated with high-risk clinicopathological parameters and BRAFV600E mutation.
26487491 2015 Stomatin-like protein 2 is overexpressed in epithelial ovarian cancer and predicts poor patient survival.
25973071 2015 Stomatin-like protein 2 expression is associated with clinical survival in patients with cervical cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25695396 2015 miRNA-1207-5p is associated with cancer progression by targeting stomatin-like protein 2 in esophageal carcinoma.
24337748 2014 Guanylate binding protein 1-mediated interaction of T cell antigen receptor signaling with the cytoskeleton.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24258357 2014 Increased expression of stomatin-like protein 2 (STOML2) predicts decreased survival in gastric adenocarcinoma: a retrospective study.
24190591 2014 Stomatin-like protein 2 is associated with the clinicopathological features of human papillary thyroid cancer and is regulated by TGF-? in thyroid cancer cells.
23918306 2014 Clinicopathological significance of SLP-2 overexpression in human gallbladder cancer.
23667687 2013 Expression of SLP-2 was associated with invasion of esophageal squamous cell carcinoma.
23371255 2013 Increased levels of SLP-2 correlate with poor prognosis in gastric cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23028053 2012 Stomatin-like protein 2 deficiency in T cells is associated with altered mitochondrial respiration and defective CD4+ T cell responses.
22623988 2012 Mitochondrial and plasma membrane pools of stomatin-like protein 2 coalesce at the immunological synapse during T cell activation.
22158085 2012 Identification and validation of novel serum markers for early diagnosis of endometriosis.
22081131 2011 SLP-2 overexpression could serve as a prognostic factor in node positive and HER2 negative breast cancer.
21791414 2011 Hyperphosphorylation of autoantigenic targets of paraproteins is due to inactivation of PP2A.
21746876 2011 Stomatin-like protein 2 binds cardiolipin and regulates mitochondrial biogenesis and function.
21501885 2012 Stomatin-domain proteins.
21269460 2011 Initial characterization of the human central proteome.
21220746 2011 Hyperphosphorylated paratarg-7: a new molecularly defined risk factor for monoclonal gammopathy of undetermined significance of the IgM type and Waldenstrom macroglobulinemia.
21209152 2011 An informatics-assisted label-free approach for personalized tissue membrane proteomics: case study on colorectal cancer.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19944461 2010 SLP-2 negatively modulates mitochondrial sodium-calcium exchange.
19839737 2010 SLP-2 overexpression is associated with tumour distant metastasis and poor prognosis in pulmonary squamous cell carcinoma.
19767238 2009 Association of a dominantly inherited hyperphosphorylated paraprotein target with sporadic and familial multiple myeloma and monoclonal gammopathy of undetermined significance: a case-control study.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19597348 2009 Downregulation of a mitochondria associated protein SLP-2 inhibits tumor cell motility, proliferation and enhances cell sensitivity to chemotherapeutic reagents.
19405124 2009 A frequent target of paraproteins in the sera of patients with multiple myeloma and MGUS.
18850735 2008 Characterization of the human COP9 signalosome complex using affinity purification and mass spectrometry.
18641330 2008 Modulation of T cell activation by stomatin-like protein 2.
18339324 2008 SLP-2 interacts with prohibitins in the mitochondrial inner membrane and contributes to their stability.
18267007 2008 Slipins: ancient origin, duplication and diversification of the stomatin protein family.
17709317 2007 High-level SLP-2 expression and HER-2/neu protein expression are associated with decreased breast cancer patient survival.
17342323 2007 Stomatin-like protein 2 is overexpressed and related to cell growth in human endometrial adenocarcinoma.
17121834 2007 Identification of a novel mitochondrial complex containing mitofusin 2 and stomatin-like protein 2.
16671055 2006 Mass spectrometrical verification of stomatin-like protein 2 (SLP-2) primary structure.
16533792 2006 Stomatin-like protein 2 is overexpressed in cancer and involved in regulating cell growth and cell adhesion in human esophageal squamous cell carcinoma.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11435687 2001 A novel member of the STOMATIN/EPB72/mec-2 family, stomatin-like 2 (STOML2), is ubiquitously expressed and localizes to HSA chromosome 9p13.1.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10713127 2000 Identification and characterization of human SLP-2, a novel homologue of stomatin (band 7.2b) present in erythrocytes and other tissues.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.