Property Summary

NCBI Gene PubMed Count 76
PubMed Score 28.32
PubTator Score 15.11

Knowledge Summary

Patent (18,039)

Expression

  Differential Expression (13)

 GWAS Trait (1)

Protein-protein Interaction (7)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (32)

PMID Text
26457732 STK4 was reduced in macrophages from human hepatoma patients and was inversely associated with the levels of IRAK1, IL-6, and phospho-p65 or phospho-STAT3. Serum STK4 levels were specifically decreased in HCC patients with high levels of IL-6.
26117625 Data indicate that two siblings with a serine/threonine kinase 4 (STK4) mutation with features of autosomal recessive (AR) hyperimmunoglobulin E syndrome and autoimmune cytopenias.
26116501 the kinase Mst1 controls selective CCR7-dependent functions in human mature dendritic cells.
25367221 The MST1/2-SAV1 complex, a core component of the Hippo pathway, promotes ciliogenesis.
24813251 Genetic inactivation of STK4 restores YAP1 levels, triggering cell death in hematologic malignancies.
24633305 Under diabetogenic conditions, MST1 was strongly activated in beta cells, and induced apoptosis via BIM upregulation, and impaired insulin secretion via phosphorylation of PDX1.
24393845 PHLPP1 is a binding protein for Mst1 and it modulates the Hippo pathway by dephosphorylating Mst1 at the inhibitory Thr(387) of Mst1.
24255178 Results indicate that changes in phosphorylation orchestrate interactions between kinases and phosphatases in Hippo (MST1/2 protein kinases) signaling, providing a putative mechanism for pathway regulation.
23647599 Inhibition of Mst1 kinase activation in cardiomyocytes protects against cell hypoxia.
23419720 Results indicated that Mst1 might be a promising anticancer target.
22739148 Low expression of MST1 may be related with the pathogenesis and prognosis of acute leukemia.
22619175 Data suggest that phosphoinositide-3-kinase/Akt and mammalian target of rapamycin (mTOR) pathway signaling differentially regulate phospho-Mst1-Thr-120/Thr-183.
22294732 STK4 deficiency is a novel human primary immunodeficiency syndrome.
22174160 MST1 mutations in autosomal recessive primary immunodeficiency characterized by defective naive T-cell survival.
22112013 Data indicate that dimerization domain of MST1 is unstructured as monomer and undergoes dimerization-induced folding. Data indicate that inhibitory domain of MST1 is disordered region both as single domain and as construct with dimerization domain.
21730291 Findings show a biological role for MICAL-1 in apoptosis and define a novel negative regulatory mechanism of MST-NDR signaling.
21516123 results show a novel PRX-I function to cause cell death in response to high levels of oxidative stress by activating MST1, which underlies the p53-dependent cytotoxicity caused by anticancer agents
21512132 MST1 was also found in androgen receptor (AR)-chromatin complexes, and enforced expression of MST1 reduced the binding of AR to a well-characterized, androgen-responsive region within the prostate-specific antigen promo
21228115 Phage microarrays containing colorectal cancer cDNA libraries were prepared to identify phage-expressed peptides recognized by tumor-specific autoantibodies from patient sera.
21199877 Through binding to MST1/2, RASSF1A supports maintenance of MST1/2 phosphorylation, promoting an active state of the MST kinases and favoring induction of apoptosis.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19962960 these findings indicate that MST1 is a major determinant of RASSF2 protein stability, and suggest that RASSF2 acts in a complex manner that extends beyond simple protein-protein association to play an important role in MST1 regulation.
19822666 Data suggest thta MST kinases 1/2 serve to monitor cytoskeletal integrity and couple the JNK1/SAPK1 pathway to the regulation of the cell cycle regulatory protein p21Waf1.
19062280 findings identify NDR1/2 as novel proapoptotic kinases and key members of the RASSF1A/MST1 signaling cascade
18986304 Mst1 is a novel mediator of cardiac troponin I phosphorylation in the heart and may contribute to the modulation of myofilament function under a variety of physiological and pathophysiological conditions
18510339 Studies provide new insights into how MST1 substrate selectivity is modulated with implications for understanding apoptotic signaling through MST1 kinase.
17932490 Mst1 and its caspase cleavage products are direct inhibitors of Akt
17726016 Akt blocks MstI-triggered FOXO3 nuclear translocation by phosphorylating MstI, promoting cell survival.
17538946 our results suggest that alteration of the Sav-RASSF1-Hpo tumor suppressor pathway may occur through hypermethylation of the CpG island promoter of MST1, MST2 and/or RASSF1A in human sarcomas
15157167 Mammalian Sterile20-like kinase 1 has a role in the regulation of apoptosis [review]
12384512 promotion of MST1-induced apoptosis by DAP4 by enabling colocalization of MST with p53
11964314 Caspase-catalyzed cleavage and activation of Mst1 correlates with eosinophil but not neutrophil apoptosis.

AA Sequence

METVQLRNPPRRQLKKLDEDSLTKQPEEVFDVLEKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEI      1 - 70
IKEISIMQQCDSPHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYL     71 - 140
HFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSL    141 - 210
GITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPF    211 - 280
VRSAKGVSILRDLINEAMDVKLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDG    281 - 350
ANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLK    351 - 420
NSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAKKRRQQNF       421 - 487
//

Text Mined References (91)

PMID Year Title
26457732 2015 STK4 regulates TLR pathways and protects against chronic inflammation-related hepatocellular carcinoma.
26117625 2015 STK4 (MST1) deficiency in two siblings with autoimmune cytopenias: A novel mutation.
26116501 2015 The Mammalian Sterile 20-like 1 Kinase Controls Selective CCR7-Dependent Functions in Human Dendritic Cells.
25367221 2014 The MST1/2-SAV1 complex of the Hippo pathway promotes ciliogenesis.
24813251 2014 Rescue of Hippo coactivator YAP1 triggers DNA damage-induced apoptosis in hematological cancers.
24633305 2014 MST1 is a key regulator of beta cell apoptosis and dysfunction in diabetes.
24393845 2014 PHLPP1 regulates contact inhibition by dephosphorylating Mst1 at the inhibitory site.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23647599 2013 Protein-L-isoaspartate (D-aspartate) O-methyltransferase protects cardiomyocytes against hypoxia induced apoptosis through inhibiting proapoptotic kinase Mst1.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23419720 2013 Effect of Mst1 overexpression on the growth of human hepatocellular carcinoma HepG2 cells and the sensitivity to cisplatin in vitro.
23386615 2013 The tumor suppressor Mst1 promotes changes in the cellular redox state by phosphorylation and inactivation of peroxiredoxin-1 protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22863277 2012 Regulation of the Hippo-YAP pathway by G-protein-coupled receptor signaling.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22739148 2012 [Expression of Hippo signaling pathway core element MST1 in acute leukemia patients and its significance].
22619175 2012 Threonine-120 phosphorylation regulated by phosphoinositide-3-kinase/Akt and mammalian target of rapamycin pathway signaling limits the antitumor activity of mammalian sterile 20-like kinase 1.
22294732 2012 The phenotype of human STK4 deficiency.
22292086 2012 Mammalian ste20-like kinase and SAV1 promote 3T3-L1 adipocyte differentiation by activation of PPAR?.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22174160 2012 MST1 mutations in autosomal recessive primary immunodeficiency characterized by defective naive T-cell survival.
22112013 2011 Dimerization-induced folding of MST1 SARAH and the influence of the intrinsically unstructured inhibitory domain: low thermodynamic stability of monomer.
21730291 2011 MICAL-1 is a negative regulator of MST-NDR kinase signaling and apoptosis.
21516123 2011 Oligomeric peroxiredoxin-I is an essential intermediate for p53 to activate MST1 kinase and apoptosis.
21512132 2011 MST1 is a multifunctional caspase-independent inhibitor of androgenic signaling.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21245099 2011 Hippo/Mst1 stimulates transcription of the proapoptotic mediator NOXA in a FoxO1-dependent manner.
21228115 2011 Identification of MST1/STK4 and SULF1 proteins as autoantibody targets for the diagnosis of colorectal cancer by using phage microarrays.
21212262 2011 MST1 promotes apoptosis through regulating Sirt1-dependent p53 deacetylation.
21199877 2011 The tumor suppressor RASSF1A prevents dephosphorylation of the mammalian STE20-like kinases MST1 and MST2.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20562859 2010 Network organization of the human autophagy system.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19962960 2010 Role of the tumor suppressor RASSF2 in regulation of MST1 kinase activity.
19940129 2010 Phosphoinositide 3-kinase/Akt inhibits MST1-mediated pro-apoptotic signaling through phosphorylation of threonine 120.
19822666 2009 MST kinases monitor actin cytoskeletal integrity and signal via c-Jun N-terminal kinase stress-activated kinase to regulate p21Waf1/Cip1 stability.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19525978 2009 RASSF2 associates with and stabilizes the proapoptotic kinase MST2.
19484742 Mammalian NDR/LATS protein kinases in hippo tumor suppressor signaling.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19062280 2008 NDR kinase is activated by RASSF1A/MST1 in response to Fas receptor stimulation and promotes apoptosis.
18986304 2009 Phosphorylation of cardiac troponin I by mammalian sterile 20-like kinase 1.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18510339 2008 Biochemical analysis of MST1 kinase: elucidation of a C-terminal regulatory region.
18328708 2008 MOBKL1A/MOBKL1B phosphorylation by MST1 and MST2 inhibits cell proliferation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932490 2007 The pro-apoptotic kinase Mst1 and its caspase cleavage products are direct inhibitors of Akt1.
17726016 2007 Akt phosphorylates MstI and prevents its proteolytic activation, blocking FOXO3 phosphorylation and nuclear translocation.
17538946 2007 Frequent hypermethylation of MST1 and MST2 in soft tissue sarcoma.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17192257 2007 Proteomics analysis of protein kinases by target class-selective prefractionation and tandem mass spectrometry.
16930133 2006 Association of mammalian sterile twenty kinases, Mst1 and Mst2, with hSalvador via C-terminal coiled-coil domains, leads to its stabilization and phosphorylation.
16892067 2006 Spatiotemporal regulation of the kinase Mst1 by binding protein RAPL is critical for lymphocyte polarity and adhesion.
16751106 2006 A conserved MST-FOXO signaling pathway mediates oxidative-stress responses and extends life span.
16510573 2006 Role of the tumor suppressor RASSF1A in Mst1-mediated apoptosis.
15688006 2005 The Ste20-like kinase Mst2 activates the human large tumor suppressor kinase Lats1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15157167 2004 Mammalian Sterile20-like kinase 1 and the regulation of apoptosis.
15109305 2004 Regulation of the MST1 kinase by autophosphorylation, by the growth inhibitory proteins, RASSF1 and NORE1, and by Ras.
15075335 2004 The scaffold protein CNK1 interacts with the tumor suppressor RASSF1A and augments RASSF1A-induced cell death.
14729613 2004 Identification of the E1A-regulated transcription factor p120 E4F as an interacting partner of the RASSF1A candidate tumor suppressor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12942774 2003 [Activator of metastasis in cancer cells, Mst1/S100A4 protein binds to tumor suppressor protein p53].
12757711 2003 Apoptotic phosphorylation of histone H2B is mediated by mammalian sterile twenty kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12384512 2002 Death-associated protein 4 binds MST1 and augments MST1-induced apoptosis.
12223493 2002 Mapping of MST1 kinase sites of phosphorylation. Activation and autophosphorylation.
11964314 2002 Caspase-catalyzed cleavage and activation of Mst1 correlates with eosinophil but not neutrophil apoptosis.
11864565 2002 Identification of a novel Ras-regulated proapoptotic pathway.
11805089 2002 Phosphorylation and dimerization regulate nucleocytoplasmic shuttling of mammalian STE20-like kinase (MST).
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11517310 2001 Caspase cleavage of MST1 promotes nuclear translocation and chromatin condensation.
11278782 2001 Both phosphorylation and caspase-mediated cleavage contribute to regulation of the Ste20-like protein kinase Mst1 during CD95/Fas-induced apoptosis.
11278283 2001 MST, a physiological caspase substrate, highly sensitizes apoptosis both upstream and downstream of caspase activation.
9545236 1998 Caspase-mediated activation and induction of apoptosis by the mammalian Ste20-like kinase Mst1.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8816758 1996 Newly identified stress-responsive protein kinases, Krs-1 and Krs-2.
8702870 1996 The Ste20-like protein kinase, Mst1, dimerizes and contains an inhibitory domain.
8566796 1995 Cloning and characterization of a member of the MST subfamily of Ste20-like kinases.
8274451 1993 Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7665586 1995 Cloning and characterization of a human protein kinase with homology to Ste20.
2902784 1988 Regional localization of chromosome 3-specific DNA fragments by using a hybrid cell deletion mapping panel.
1655021 1991 Characterization of the DNF15S2 locus on human chromosome 3: identification of a gene coding for four kringle domains with homology to hepatocyte growth factor.