Property Summary

NCBI Gene PubMed Count 23
PubMed Score 12.54
PubTator Score 8.31

Knowledge Summary

Patent (2,325)

Expression

  Differential Expression (18)

Disease log2 FC p
hepatocellular carcinoma 1.200 4.0e-05
pancreatic cancer 1.200 3.5e-03
malignant mesothelioma -3.500 5.8e-07
astrocytic glioma 1.100 3.8e-02
posterior fossa group B ependymoma 1.300 8.1e-10
medulloblastoma -1.600 3.0e-05
glioblastoma -1.700 8.0e-04
atypical teratoid / rhabdoid tumor -2.100 9.0e-08
medulloblastoma, large-cell -2.500 6.6e-07
primitive neuroectodermal tumor -1.300 6.2e-03
tuberculosis and treatment for 6 months -2.700 5.7e-07
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-02
lung cancer 1.200 3.3e-04
diabetes mellitus -1.200 6.2e-03
pediatric high grade glioma -1.200 3.0e-03
pancreatic carcinoma 1.200 3.5e-03
ovarian cancer 1.600 2.3e-03
Breast cancer 1.300 7.0e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (10)

PMID Text
23897809 cyclin D1 has a role in promoting cell cycle progression by enhancing NDR1/2 kinase activity independent of Cdk4
23435566 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by triggering the switch in binding specificity of Rabin8 from PS to Sec15.
21262772 These findings establish a novel MST3-NDR-p21 axis as an important regulator of G(1)/S progression of mammalian cells.
19240061 Observational study of gene-disease association. (HuGE Navigator)
19062280 findings identify NDR1/2 as novel proapoptotic kinases and key members of the RASSF1A/MST1 signaling cascade
16488889 NDR2 is an upstream kinase of ARK5 that plays an essential role in tumor progression through ARK5
16314523 Activation of NDR2 is a multistep process involving phosphorylation of the hydrophobic motif site Thr444/2 by MST3, autophosphorylation of Ser281/2, and binding of MOB1A.
15582665 The NDR1 and NDR2 kinases were incorporated into HIV-1 particles and were cleaved by the HIV-1 protease.
15582665 Two related serine-threonine kinases, nuclear Dbf2 related 1 (NDR1) and NDR2, are incorporated into HIV-1 particles and are cleaved by the HIV-1 protease (PR), both within virions and within producer cells
15067004 NDR1 and NDR2 serine-threonine kinases are regulated by mob proteins

AA Sequence

MAMTAGTTTTFPMSNHTRERVTVAKLTLENFYSNLILQHEERETRQKKLEVAMEEEGLADEEKKLRRSQH      1 - 70
ARKETEFLRLKRTRLGLDDFESLKVIGRGAFGEVRLVQKKDTGHIYAMKILRKSDMLEKEQVAHIRAERD     71 - 140
ILVEADGAWVVKMFYSFQDKRNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYISETVLAIDAIHQLGFI    141 - 210
HRDIKPDNLLLDAKGHVKLSDFGLCTGLKKAHRTEFYRNLTHNPPSDFSFQNMNSKRKAETWKKNRRQLA    211 - 280
YSTVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYRKVMNWKETLVFPPEVPI    281 - 350
SEKAKDLILRFCIDSENRIGNSGVEEIKGHPFFEGVDWEHIRERPAAIPIEIKSIDDTSNFDDFPESDIL    351 - 420
QPVPNTTEPDYKSKDWVFLNYTYKRFEGLTQRGSIPTYMKAGKL                              421 - 464
//

Text Mined References (29)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23897809 2013 Cyclin D1 promotes cell cycle progression through enhancing NDR1/2 kinase activity independent of cyclin-dependent kinase 4.
23435566 2013 NDR2-mediated Rabin8 phosphorylation is crucial for ciliogenesis by switching binding specificity from phosphatidylserine to Sec15.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
21262772 2011 Human NDR kinases control G(1)/S cell cycle transition by directly regulating p21 stability.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19062280 2008 NDR kinase is activated by RASSF1A/MST1 in response to Fas receptor stimulation and promotes apoptosis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16541075 2006 The finished DNA sequence of human chromosome 12.
16488889 2006 NDR2 acts as the upstream kinase of ARK5 during insulin-like growth factor-1 signaling.
16314523 2005 Regulation of NDR protein kinase by hydrophobic motif phosphorylation mediated by the mammalian Ste20-like kinase MST3.
15582665 2005 HIV-1 incorporates and proteolytically processes human NDR1 and NDR2 serine-threonine kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15197186 2004 Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein.
15067004 2004 Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases.
15037617 2004 Regulation of NDR2 protein kinase by multi-site phosphorylation and the S100B calcium-binding protein.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.