Property Summary

NCBI Gene PubMed Count 46
PubMed Score 20.77
PubTator Score 90.73

Knowledge Summary

Patent (16,458)

Expression

  Differential Expression (12)

Gene RIF (21)

PMID Text
26387716 Data establish STK38 as a conserved regulator of autophagy in human cells and flies.
26057687 PLK1-mediated phosphorylation protects the binding of Mob1 to NDR1 and subsequent NDR1 activation
25936524 STK38-mediated phosphorylation of CDC25A at Ser-76 and the subsequent degradation of CDC25A are required to promote DNA damage-induced G2/M checkpoint activation.
23897809 cyclin D1 has a role in promoting cell cycle progression by enhancing NDR1/2 kinase activity independent of Cdk4
23886587 17-allylamino-17-demethoxygeldanamycin down-regulates STK38, modulating radiosensitivity.
23178486 STK38 regulates MYC protein stability and turnover in a kinase activity-dependent manner. STK38 kinase inactivation abrogates apoptosis following B-cell receptor activation, whereas its silencing significantly decreases MYC levels and increases apoptosis.
22674419 Findings suggest a function of NDR1, which may regulate NF-kappaB activation by its kinase activity.
22142472 GSK-3beta inhibits full activation of STK38, and STK38 activation is required to prevent cell death in response to oxidative stress
21730291 Findings show a biological role for MICAL-1 in apoptosis and define a novel negative regulatory mechanism of MST-NDR signaling.
21262772 These findings establish a novel MST3-NDR-p21 axis as an important regulator of G(1)/S progression of mammalian cells.
20624913 Data indicate that human MOB2 is a negative regulator of human NDR kinases in biochemical and biological settings.
19327996 Results suggest that MST2-, Fry-, and MOB2-mediated activation of NDR1 is crucial for the fidelity of mitotic chromosome alignment in mammalian cells.
19062280 findings identify NDR1/2 as novel proapoptotic kinases and key members of the RASSF1A/MST1 signaling cascade
19058789 Observational study of gene-disease association. (HuGE Navigator)
18362890 phosphorylation of MOB1 at Thr74 by MST2 is essential to make a complex of MOB1, MST2 and NDR1, and to fully activate NDR1
17317633 These data indicate that NDR-driven centrosome duplication requires Cdk2 activity and that Cdk2-induced centrosome amplification is affected upon reduction of NDR activity.
16135814 In vivo activation of human NDR by membrane-bound hMOBs is dependent on their interaction and occurs solely at the membrane.
15582665 The NDR1 and NDR2 kinases were incorporated into HIV-1 particles and were cleaved by the HIV-1 protease.
15582665 Two related serine-threonine kinases, nuclear Dbf2 related 1 (NDR1) and NDR2, are incorporated into HIV-1 particles and are cleaved by the HIV-1 protease (PR), both within virions and within producer cells
15197186 an insert within the catalytic domain between subdomains VII and VIII is autoinhibitory, and the binding of human MOB1 to the N-terminal domain of NDR induces the release of this autoinhibition.
15067004 NDR1 and NDR2 serine-threonine kinases are regulated by mob proteins

AA Sequence

MAMTGSTPCSSMSNHTKERVTMTKVTLENFYSNLIAQHEEREMRQKKLEKVMEEEGLKDEEKRLRRSAHA      1 - 70
RKETEFLRLKRTRLGLEDFESLKVIGRGAFGEVRLVQKKDTGHVYAMKILRKADMLEKEQVGHIRAERDI     71 - 140
LVEADSLWVVKMFYSFQDKLNLYLIMEFLPGGDMMTLLMKKDTLTEEETQFYIAETVLAIDSIHQLGFIH    141 - 210
RDIKPDNLLLDSKGHVKLSDFGLCTGLKKAHRTEFYRNLNHSLPSDFTFQNMNSKRKAETWKRNRRQLAF    211 - 280
STVGTPDYIAPEVFMQTGYNKLCDWWSLGVIMYEMLIGYPPFCSETPQETYKKVMNWKETLTFPPEVPIS    281 - 350
EKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILK    351 - 420
PTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK                             421 - 465
//

Text Mined References (54)

PMID Year Title
26387716 2015 The Pro-apoptotic STK38 Kinase Is a New Beclin1 Partner Positively Regulating Autophagy.
26057687 2015 Regulation of NDR1 activity by PLK1 ensures proper spindle orientation in mitosis.
25936524 2015 Serine-Threonine Kinase 38 regulates CDC25A stability and the DNA damage-induced G2/M checkpoint.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25601544 2015 NDR functions as a physiological YAP1 kinase in the intestinal epithelium.
25576923 2015 Sema6A and Mical1 control cell growth and survival of BRAFV600E human melanoma cells.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24928906 2014 Rassf5 and Ndr kinases regulate neuronal polarity through Par3 phosphorylation in a novel pathway.
24786771 2014 Phosphorylation-dephosphorylation cycle of HP1? governs accurate mitotic progression.
24747552 2014 Constitutively active NDR1-PIF kinase functions independent of MST1 and hMOB1 signalling.
24568526 2014 Asiatic acid promotes p21(WAF1/CIP1) protein stability through attenuation of NDR1/2 dependent phosphorylation of p21(WAF1/ CIP1) in HepG2 human hepatoma cells.
23985307 2013 Regulation and functions of mammalian LATS/NDR kinases: looking beyond canonical Hippo signalling.
23897809 2013 Cyclin D1 promotes cell cycle progression through enhancing NDR1/2 kinase activity independent of cyclin-dependent kinase 4.
23886587 2013 The HSP90 inhibitor 17-allylamino-17-demethoxygeldanamycin modulates radiosensitivity by downregulating serine/threonine kinase 38 via Sp1 inhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23178486 2013 STK38 is a critical upstream regulator of MYC's oncogenic activity in human B-cell lymphoma.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
22674419 2012 NDR1/STK38 potentiates NF-?B activation by its kinase activity.
22445341 2012 Chemical genetic identification of NDR1/2 kinase substrates AAK1 and Rabin8 Uncovers their roles in dendrite arborization and spine development.
22142472 2012 Serine-threonine kinase 38 is regulated by glycogen synthase kinase-3 and modulates oxidative stress-induced cell death.
21730291 2011 MICAL-1 is a negative regulator of MST-NDR kinase signaling and apoptosis.
21269460 2011 Initial characterization of the human central proteome.
21262772 2011 Human NDR kinases control G(1)/S cell cycle transition by directly regulating p21 stability.
20624913 2010 Differential NDR/LATS interactions with the human MOB family reveal a negative role for human MOB2 in the regulation of human NDR kinases.
20551432 2010 Ablation of the kinase NDR1 predisposes mice to the development of T cell lymphoma.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19377461 2009 GlcNAcylation of a histone methyltransferase in retinoic-acid-induced granulopoiesis.
19327996 2009 MST2- and Furry-mediated activation of NDR1 kinase is critical for precise alignment of mitotic chromosomes.
19062280 2008 NDR kinase is activated by RASSF1A/MST1 in response to Fas receptor stimulation and promotes apoptosis.
19058789 2009 A common variant in DRD3 receptor is associated with autism spectrum disorder.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18362890 2008 Threonine 74 of MOB1 is a putative key phosphorylation site by MST2 to form the scaffold to activate nuclear Dbf2-related kinase 1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17906693 2008 Negative regulation of MEKK1/2 signaling by serine-threonine kinase 38 (STK38).
17620599 2007 Functional specialization of beta-arrestin interactions revealed by proteomic analysis.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17317633 2007 Centrosome-associated NDR kinase regulates centrosome duplication.
16884686 2006 Identification and Herc5-mediated ISGylation of novel target proteins.
16135814 2005 Human NDR kinases are rapidly activated by MOB proteins through recruitment to the plasma membrane and phosphorylation.
15670829 2005 Identification of proteins interacting with the RNAPII FCP1 phosphatase: FCP1 forms a complex with arginine methyltransferase PRMT5 and it is a substrate for PRMT5-mediated methylation.
15582665 2005 HIV-1 incorporates and proteolytically processes human NDR1 and NDR2 serine-threonine kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15197186 2004 Mechanism of activation of NDR (nuclear Dbf2-related) protein kinase by the hMOB1 protein.
15067004 2004 Human Mob proteins regulate the NDR1 and NDR2 serine-threonine kinases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14661952 2003 Structure of the Ca2+/S100B/NDR kinase peptide complex: insights into S100 target specificity and activation of the kinase.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12493777 2003 Mechanism of Ca2+-mediated regulation of NDR protein kinase through autophosphorylation and phosphorylation by an upstream kinase.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9774336 1998 Calcium regulation of Ndr protein kinase mediated by S100 calcium-binding proteins.
9647638 1998 Physical map of human 6p21.2-6p21.3: region flanking the centromeric end of the major histocompatibility complex.
7761441 1995 Molecular cloning and characterization of a conserved nuclear serine(threonine) protein kinase.