Property Summary

NCBI Gene PubMed Count 10
PubMed Score 40.07
PubTator Score 4.83

Knowledge Summary

Patent (2,155)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 3.1e-03
ependymoma -1.200 7.1e-03
osteosarcoma -1.190 5.2e-04
glioblastoma -1.600 6.8e-05
atypical teratoid / rhabdoid tumor -1.900 1.5e-07
medulloblastoma -1.200 1.6e-02
medulloblastoma, large-cell -1.400 7.7e-03
primitive neuroectodermal tumor -1.500 1.7e-03
adult high grade glioma -1.700 3.7e-04
pilocytic astrocytoma -1.300 1.0e-04

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1)

PMID Text
20580033 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQWSKWKKRMGS      1 - 70
SMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYAMKYMNKQQCIERDEVRNVFR     71 - 140
ELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRYHLQQNVQFSEDTVRLYICEMALALDYLRGQ    141 - 210
HIIHRDVKPDNILLDERGHAHLTDFNIATIIKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWS    211 - 280
VGVMAYELLRGWRPYDIHSSNAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAA    281 - 350
PALAGVLWDHLSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND    351 - 420
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPICPSAGSG        421 - 486
//

Text Mined References (14)

PMID Year Title
24929637 2014 Genome-wide methylomic analysis of monozygotic twins discordant for adolescent depression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20580033 2010 Replication of recently described type 2 diabetes gene variants in a South Indian population.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471243 2002 The protein kinase complement of the human genome.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.