Property Summary

Ligand Count 1
NCBI Gene PubMed Count 11
PubMed Score 6.09
PubTator Score 7.17

Knowledge Summary

Patent (2,140)


Gene RIF (4)

AA Sequence

PNPEKDTEYTLYKKEEEIKTENLDKCMEKTRNGEANFDC                                   981 - 1019

Text Mined References (13)

PMID Year Title