Property Summary

Ligand Count 6
NCBI Gene PubMed Count 67
PubMed Score 11.29
PubTator Score 55.36

Knowledge Summary

Patent (2,419)

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 1.168 2.4e-02
glioblastoma multiforme 1.200 1.1e-21
group 4 medulloblastoma -1.300 2.3e-02
intraductal papillary-mucinous neoplasm ... 1.100 4.8e-02
malignant mesothelioma 1.200 1.8e-06
ovarian cancer 1.200 1.7e-02
pancreatic cancer 1.100 3.2e-03
pancreatic carcinoma 1.100 3.2e-03
pituitary cancer -1.100 2.5e-07
psoriasis -2.200 3.9e-05
subependymal giant cell astrocytoma 1.786 2.8e-02

Gene RIF (37)

AA Sequence

MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKE      1 - 70
ISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFM     71 - 140
RKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGIT    141 - 210
SIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN    211 - 280
AKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM    281 - 350
IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM    351 - 420
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQN    421 - 490
F//

Text Mined References (78)

PMID Year Title