Property Summary

NCBI Gene PubMed Count 59
PubMed Score 11.06
PubTator Score 55.36

Knowledge Summary

Patent (2,419)

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 3.2e-03
malignant mesothelioma 1.200 1.8e-06
psoriasis -2.200 3.9e-05
glioblastoma multiforme 1.200 1.1e-21
intraductal papillary-mucinous neoplasm ... 1.100 4.8e-02
active Crohn's disease 1.168 2.4e-02
group 4 medulloblastoma -1.300 2.3e-02
pancreatic carcinoma 1.100 3.2e-03
subependymal giant cell astrocytoma 1.786 2.8e-02
ovarian cancer 1.200 1.7e-02
pituitary cancer -1.100 2.5e-07

 GWAS Trait (1)

Protein-protein Interaction (7)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (31)

PMID Text
25814670 using an Mst2 mutation that disrupts homotypic dimerization, we showed that the monomeric Mst2-SARAH domain could form a stable complex of 1:1 stoichiometric ratio with WW45 refolded under acidic pH.
25367221 The MST1/2-SAV1 complex, a core component of the Hippo pathway, promotes ciliogenesis.
25035424 results reveal a novel role of Mst2 in stress-dependent cardiac hypertrophy and remodeling in the adult mouse and likely human heart
24992339 These results suggest that AIF downregulation is a common event in kidney tumor development. AIF loss may lead to decreased STK3 activity, defective apoptosis and malignant transformation
24881775 Hippo and Yap regulate cardiomyocyte death and regeneration.
24255178 Results indicate that changes in phosphorylation orchestrate interactions between kinases and phosphatases in Hippo (MST1/2 protein kinases) signaling, providing a putative mechanism for pathway regulation.
24180524 results of the present study revealed that, in addition to the phosphorylated YAP/TAZ, the Hippo pathway can suppress the Wnt/beta-catenin pathway directly through MST1/2
23972470 RASSF5 can act as an inhibitor or a potential positive regulator of Mst2, depending on whether it binds to Mst2 before or after activation-loop phosphorylation.
23459937 The ability of K-Ras to activate MST2 and MST2-dependent apoptosis is determined by the differential activation kinetics of mutant K-Ras and wild type K-Ras.
22590567 The identification of the c-Abl tyrosine kinase as a novel upstream activator of MST2 suggests that the conserved c-Abl-MST signaling cascade plays an important role in oxidative stress-induced neuronal cell death.
22195963 The small number of tumors with co-expression of mutant K-Ras and MST2 has elevated apoptosis rates.
22102242 crystals of MST2 belonged to space group P2, with unit-cell parameters a = 62.0, b = 119.2, c = 62.0 A, alpha = 90.0, beta = 90.5, gamma = 90.0 degrees , or to space group P6(1)22, with unit-cell parameters a = 54.5, b = 54.5, c = 303.1 A
21944251 The mammalian ste20-like kinase mediated phosphorylation of four residues within SAV1 may be important in the induction of cell death by the MST pathway.
21199877 Through binding to MST1/2, RASSF1A supports maintenance of MST1/2 phosphorylation, promoting an active state of the MST kinases and favoring induction of apoptosis.
21104395 MST and hSAV act as novel co-regulators of ERalpha and may play an important role in breast cancer pathogenesis.
21076410 Study reports that two Hippo pathway components, Mst2 and the scaffold protein hSav1, directly interact with Nek2A and regulate its ability to localize to centrosomes, and phosphorylate C-Nap1 and rootletin.
20231902 ste20-like kinase MST2 is regulated by the IGF1-Akt pathway
20212043 studies reveal a more complex role for Mst2 than previously thought. The Mst2 --> LATS1/2 pathway, by maintaining PP2A-C levels, may, in some situations, positively affect mitogenic signaling
20145135 hnRNP H blocks MST2-mediated apoptosis in cancer cells by regulating A-Raf transcription.
20086174 Data show T117/T384 as Akt phosphorylation sites in MST2, and mutation of these sites inhibited MST2 binding to Raf-1 but enhanced binding to RASSF1A, accentuating downstream c-jun N-Terminal Kinase and p38 MAPK signaling and promoting apoptosis.
19822666 Data suggest thta MST kinases 1/2 serve to monitor cytoskeletal integrity and couple the JNK1/SAPK1 pathway to the regulation of the cell cycle regulatory protein p21Waf1.
19525978 MST2 and RASSF2 form an active complex in vivo, in which RASSF2 is maintained in a phosphorylated state and protects MST2 from degradation and turnover
19327996 Results suggest that MST2-, Fry-, and MOB2-mediated activation of NDR1 is crucial for the fidelity of mitotic chromosome alignment in mammalian cells.
18640976 Overexpression of YAP2 in cells promoted apoptosis, whereas the Mst2/Lats1-induced phosphorylation of YAP partially rescued the cells from apoptotic death.
18362890 phosphorylation of MOB1 at Thr74 by MST2 is essential to make a complex of MOB1, MST2 and NDR1, and to fully activate NDR1
17889669 These results describe an MST2-dependent effector pathway for RASSF1A proapoptotic signaling and indicate that silencing of RASSF1A in tumors removes a proapoptotic signal emanating from p73.
17538946 our results suggest that alteration of the Sav-RASSF1-Hpo tumor suppressor pathway may occur through hypermethylation of the CpG island promoter of MST1, MST2 and/or RASSF1A in human sarcomas.
15688006 Mst2-like kinases regulate Lats kinase activities in an evolutionarily conserved regulatory pathway.
15618521 proteomic analysis of Raf-1 signaling complexes was used to show that Raf-1 counteracts apoptosis by suppressing the activation of mammalian sterile 20-like kinase (MST2)
12554736 novel mechanism for MST2 regulation in apoptotic cells postulated; during apoptosis MST2 is cleaved by caspase-3 and undergoes irreversible autophosphorylation resulting in the accumulation of active MST2
11964314 Caspase-catalyzed cleavage and activation of Mst2 correlates with eosinophil but not neutrophil apoptosis.

AA Sequence

MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKE      1 - 70
ISIMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIEDEIATILKSTLKGLEYLHFM     71 - 140
RKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVIQEIGYNCVADIWSLGIT    141 - 210
SIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFIKN    211 - 280
AKPVSILRDLITEAMEIKAKRHEEQQRELEEEEENSDEDELDSHTMVKTSVESVGTMRATSTMSEGAQTM    281 - 350
IEHNSTMLESDLGTMVINSEDEEEEDGTMKRNATSPQVQRPSFMDYFDKQDFKNKSHENCNQNMHEPFPM    351 - 420
SKNVFPDNWKVPQDGDFDFLKNLSLEELQMRLKALDPMMEREIEELRQRYTAKRQPILDAMDAKKRRQQN    421 - 490
F//

Text Mined References (70)

PMID Year Title
25814670 2015 Low pH-driven folding of WW45-SARAH domain leads to stabilization of the WW45-Mst2 complex.
25416956 2014 A proteome-scale map of the human interactome network.
25367221 2014 The MST1/2-SAV1 complex of the Hippo pathway promotes ciliogenesis.
25035424 2014 The mammalian Ste20-like kinase 2 (Mst2) modulates stress-induced cardiac hypertrophy.
24992339 2014 AIF downregulation and its interaction with STK3 in renal cell carcinoma.
24881775 2014 Harnessing Hippo in the heart: Hippo/Yap signaling and applications to heart regeneration and rejuvenation.
24366813 2013 Interaction proteome of human Hippo signaling: modular control of the co-activator YAP1.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
24180524 2014 Mammalian sterile 20-like kinase 1/2 inhibits the Wnt/?-catenin signalling pathway by directly binding casein kinase 1?.
23972470 2013 Structural basis for autoactivation of human Mst2 kinase and its regulation by RASSF5.
23459937 2013 The differential effects of wild-type and mutated K-Ras on MST2 signaling are determined by K-Ras activation kinetics.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23386615 2013 The tumor suppressor Mst1 promotes changes in the cellular redox state by phosphorylation and inactivation of peroxiredoxin-1 protein.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22590567 2012 Regulation of neuronal cell death by c-Abl-Hippo/MST2 signaling pathway.
22292086 2012 Mammalian ste20-like kinase and SAV1 promote 3T3-L1 adipocyte differentiation by activation of PPAR?.
22195963 2011 Mutant K-Ras activation of the proapoptotic MST2 pathway is antagonized by wild-type K-Ras.
22102242 2011 Crystallization and preliminary X-ray crystallographic study of the human MST2 SARAH domain.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21944251 2011 Phosphorylation of SAV1 by mammalian ste20-like kinase promotes cell death.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21199877 2011 The tumor suppressor RASSF1A prevents dephosphorylation of the mammalian STE20-like kinases MST1 and MST2.
21104395 2011 Mammalian MST2 kinase and human Salvador activate and reduce estrogen receptor alpha in the absence of ligand.
21076410 2010 Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.
20920251 2010 Frequent epigenetic inactivation of RASSF2 in thyroid cancer and functional consequences.
20562859 2010 Network organization of the human autophagy system.
20412773 2010 The Hippo pathway regulates Wnt/beta-catenin signaling.
20231902 2010 Regulation of proapoptotic mammalian ste20-like kinase MST2 by the IGF1-Akt pathway.
20212043 2010 Mammalian Ste20-like kinase (Mst2) indirectly supports Raf-1/ERK pathway activity via maintenance of protein phosphatase-2A catalytic subunit levels and consequent suppression of inhibitory Raf-1 phosphorylation.
20145135 2010 Heterogeneous nuclear ribonucleoprotein H blocks MST2-mediated apoptosis in cancer cells by regulating A-Raf transcription.
20086174 2010 Proapoptotic kinase MST2 coordinates signaling crosstalk between RASSF1A, Raf-1, and Akt.
19962960 2010 Role of the tumor suppressor RASSF2 in regulation of MST1 kinase activity.
19822666 2009 MST kinases monitor actin cytoskeletal integrity and signal via c-Jun N-terminal kinase stress-activated kinase to regulate p21Waf1/Cip1 stability.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19525978 2009 RASSF2 associates with and stabilizes the proapoptotic kinase MST2.
19484742 Mammalian NDR/LATS protein kinases in hippo tumor suppressor signaling.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19327996 2009 MST2- and Furry-mediated activation of NDR1 kinase is critical for precise alignment of mitotic chromosomes.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18640976 2008 Mst2 and Lats kinases regulate apoptotic function of Yes kinase-associated protein (YAP).
18362890 2008 Threonine 74 of MOB1 is a putative key phosphorylation site by MST2 to form the scaffold to activate nuclear Dbf2-related kinase 1.
18347058 2008 The RASSF1A tumor suppressor restrains anaphase-promoting complex/cyclosome activity during the G1/S phase transition to promote cell cycle progression in human epithelial cells.
18328708 2008 MOBKL1A/MOBKL1B phosphorylation by MST1 and MST2 inhibits cell proliferation.
17889669 2007 RASSF1A elicits apoptosis through an MST2 pathway directing proapoptotic transcription by the p73 tumor suppressor protein.
17538946 2007 Frequent hypermethylation of MST1 and MST2 in soft tissue sarcoma.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16930133 2006 Association of mammalian sterile twenty kinases, Mst1 and Mst2, with hSalvador via C-terminal coiled-coil domains, leads to its stabilization and phosphorylation.
16510573 2006 Role of the tumor suppressor RASSF1A in Mst1-mediated apoptosis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15688006 2005 The Ste20-like kinase Mst2 activates the human large tumor suppressor kinase Lats1.
15618521 2004 Role of the kinase MST2 in suppression of apoptosis by the proto-oncogene product Raf-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15109305 2004 Regulation of the MST1 kinase by autophosphorylation, by the growth inhibitory proteins, RASSF1 and NORE1, and by Ras.
14729613 2004 Identification of the E1A-regulated transcription factor p120 E4F as an interacting partner of the RASSF1A candidate tumor suppressor gene.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12554736 2003 Regulation of mammalian STE20-like kinase 2 (MST2) by protein phosphorylation/dephosphorylation and proteolysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11964314 2002 Caspase-catalyzed cleavage and activation of Mst1 correlates with eosinophil but not neutrophil apoptosis.
11278283 2001 MST, a physiological caspase substrate, highly sensitizes apoptosis both upstream and downstream of caspase activation.
10840030 2000 Detection of a novel quiescence-dependent protein kinase.
8816758 1996 Newly identified stress-responsive protein kinases, Krs-1 and Krs-2.
8816756 1996 Signal termination in bacterial chemotaxis: CheZ mediates dephosphorylation of free rather than switch-bound CheY.
8566796 1995 Cloning and characterization of a member of the MST subfamily of Ste20-like kinases.
8274451 1993 Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.
7665586 1995 Cloning and characterization of a human protein kinase with homology to Ste20.
7566098 1995 Initial assessment of human gene diversity and expression patterns based upon 83 million nucleotides of cDNA sequence.