Property Summary

NCBI Gene PubMed Count 34
PubMed Score 19.94
PubTator Score 17.18

Knowledge Summary

Patent (3,124)

TINX Plot

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus -1.100 3.7e-03
ovarian cancer 1.700 1.4e-06

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (11)

PMID Text
26553096 STK25 regulates lipid partitioning in human liver cells by controlling TAG synthesis as well as lipolytic activity and thereby NEFA release from lipid droplets for beta-oxidation and TAG secretion.
25550858 Our results suggest that MST4, STK25 and PDCD10 are upregulated in prostate cancer and may play roles in prostate tumorigenesis.
23889253 This review notes that all 3 human germinal center kinase III genes consist of 12 exons and are ubiquitously expressed. In SOK1 and MST4, exon 1 encodes a 5' untranslated region, but this is not the case for MST3.
22782892 Down-modulation of STK25, but not STK24, rescued medulloblastoma cells from NGF-induced TrkA-dependent cell death, suggesting that STK25 is part of the death-signaling pathway initiated by TrkA and CCM2.
22652780 PDCD10 might be a regulatory adaptor required for STK25 functions, which differ distinctly depending on the redox status of the cells that may be potentially related to tumor progression.
22391949 Significantly higher STK25 levels were observed in the skeletal muscle of type 2 diabetic patients, compared with individuals with normal glucose tolerance.
21396913 The results of the study results indicate that attenuation of SOK1 enhanced cell migration and lead to changes in the expression of migration-associated proteins such as FAK and GM130.
20592472 In cultured human endothelial cells, CCM3 and STK25 regulated barrier function in a manner similar to CCM2, and STKs negatively regulated Rho by directly activating moesin.
18364353 SOK1 entry into the nucleus is important for the cell death response
17253963 Ste20 family member (MAP4K3) that is required for maximal S6K (S6 kinase)/4E-BP1 [eIF4E (eukaryotic initiation factor 4E) that is required for maximal S6K (S6 kinase).
15037601 14-3-3zeta is a specific substrate for YSK1 that localizes to the Golgi apparatus, and potentially links YSK1 signaling at the Golgi apparatus with protein transport.

AA Sequence

MAHLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEDEIEDIQQEITVL      1 - 70
SQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRD     71 - 140
IKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAK    141 - 210
GEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFL    211 - 280
TELIDRYKRWKSEGHGEESSSEDSDIDGEAEDGEQGPIWTFPPTIRPSPHSKLHKGTALHSSQKPAEPVK    281 - 350
RQPRSQCLSTLVRPVFGELKEKHKQSGGSVGALEELENAFSLAEESCPGISDKLMVHLVERVQRFSHNRN    351 - 420
HLTSTR                                                                    421 - 426
//

Text Mined References (35)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26553096 2016 Protein kinase STK25 controls lipid partitioning in hepatocytes and correlates with liver fat content in humans.
25550858 2014 Differential expression of MST4, STK25 and PDCD10 between benign prostatic hyperplasia and prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
23889253 2013 SOcK, MiSTs, MASK and STicKs: the GCKIII (germinal centre kinase III) kinases and their heterologous protein-protein interactions.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
22782892 2012 STK25 protein mediates TrkA and CCM2 protein-dependent death in pediatric tumor cells of neural origin.
22652780 2012 PDCD10 interacts with STK25 to accelerate cell apoptosis under oxidative stress.
22391949 2012 Serine/threonine protein kinase 25 (STK25): a novel negative regulator of lipid and glucose metabolism in rodent and human skeletal muscle.
22291017 2012 Adaptor protein cerebral cavernous malformation 3 (CCM3) mediates phosphorylation of the cytoskeletal proteins ezrin/radixin/moesin by mammalian Ste20-4 to protect cells from oxidative stress.
21561863 2011 CCM3/PDCD10 heterodimerizes with germinal center kinase III (GCKIII) proteins using a mechanism analogous to CCM3 homodimerization.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21423148 2011 MO25 is a master regulator of SPAK/OSR1 and MST3/MST4/YSK1 protein kinases.
21396913 2011 Downregulation of SOK1 promotes the migration of MCF-7 cells.
21269460 2011 Initial characterization of the human central proteome.
20592472 2010 CCM3 signaling through sterile 20-like kinases plays an essential role during zebrafish cardiovascular development and cerebral cavernous malformations.
20332113 2010 CCM3/PDCD10 stabilizes GCKIII proteins to promote Golgi assembly and cell orientation.
18782753 2009 A PP2A phosphatase high density interaction network identifies a novel striatin-interacting phosphatase and kinase complex linked to the cerebral cavernous malformation 3 (CCM3) protein.
18364353 2008 SOK1 translocates from the Golgi to the nucleus upon chemical anoxia and induces apoptotic cell death.
17657516 2007 CCM3 interacts with CCM2 indicating common pathogenesis for cerebral cavernous malformations.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17253963 2007 A MAP4 kinase related to Ste20 is a nutrient-sensitive regulator of mTOR signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15037601 2004 YSK1 is activated by the Golgi matrix protein GM130 and plays a role in cell migration through its substrate 14-3-3zeta.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9160885 1997 YSK1, a novel mammalian protein kinase structurally related to Ste20 and SPS1, but is not involved in the known MAPK pathways.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8887545 1996 Activation of a human Ste20-like kinase by oxidant stress defines a novel stress response pathway.