Property Summary

NCBI Gene PubMed Count 13
PubMed Score 25.34
PubTator Score 15.45

Knowledge Summary

Patent (3,914)

Expression

  Differential Expression (21)

Disease log2 FC p
Rheumatoid Arthritis 1.800 2.5e-03
hepatocellular carcinoma -1.200 1.1e-03
chronic lymphosyte leukemia -1.900 1.4e-11
urothelial carcinoma -1.600 1.3e-03
malignant mesothelioma -1.100 1.2e-03
cutaneous lupus erythematosus 1.500 7.8e-03
astrocytoma 1.300 1.7e-14
oligodendroglioma 1.100 1.5e-09
medulloblastoma -1.100 3.6e-03
juvenile dermatomyositis 1.071 6.2e-08
primary pancreatic ductal adenocarcinoma 1.173 3.5e-03
tuberculosis and treatment for 6 months 1.300 4.2e-06
lung cancer -2.900 2.2e-05
diabetes mellitus -1.700 2.3e-02
Breast cancer 3.100 2.6e-02
interstitial cystitis 1.600 6.2e-05
psoriasis -1.200 6.4e-06
lung carcinoma -3.200 3.5e-37
invasive ductal carcinoma 1.400 9.2e-03
ulcerative colitis -1.500 5.0e-04
ovarian cancer 2.800 3.9e-05

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (9)

PMID Text
24086368 A significant interaction between variants in STK17B and PAX8, in papillary thyroid cancer susceptibility, is reported.
23398943 ChIP assays showed that in U937 cells MYB binds to a conserved element upstream of the DRAK2 transcription start site.
23122956 DRAK2 protein directly binds to the type I TGF-beta receptor and Knockdown of DRAK2 suppresses the tumorigenic ability of breast cancer cells.
21148796 DRAK2 and protein kinase D form a novel signaling module that controls calcium homeostasis following T cell activation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)
19638987 Regulation of the apoptosis-inducing kinase DRAK2 by cyclooxygenase-2 in colorectal cancer.
19542440 Strong suppression of T cell receptor signals during thymic selection caused by ectopic DRAK2 expression in a DRAK2 transgenic mouse model of autoimmune encephalomyelitis alters the responsiveness of peripheral T cells.
17182616 DRAK2 kinase activity is regulated in a calcium-dependent manner and that Ser(12) phosphorylation is necessary for optimal suppression of T cell activation by this kinase

AA Sequence

MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRG      1 - 70
QDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIK     71 - 140
QILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYD    141 - 210
PITTATDMWNIGIIAYMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEK    211 - 280
RPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMV    281 - 350
SKRFRFDDSLPNPHELVSDLLC                                                    351 - 372
//

Text Mined References (16)

PMID Year Title
24086368 2013 An epistatic interaction between the PAX8 and STK17B genes in papillary thyroid cancer susceptibility.
23398943 2013 The MYB oncogene can suppress apoptosis in acute myeloid leukemia cells by transcriptional repression of DRAK2 expression.
23122956 2012 DRAK2 participates in a negative feedback loop to control TGF-?/Smads signaling by binding to type I TGF-? receptor.
21148796 2011 Protein kinase D orchestrates the activation of DRAK2 in response to TCR-induced Ca2+ influx and mitochondrial reactive oxygen generation.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19638987 2009 Regulation of the apoptosis-inducing kinase DRAK2 by cyclooxygenase-2 in colorectal cancer.
19542440 2009 Altered thymic selection and increased autoimmunity caused by ectopic expression of DRAK2 during T cell development.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17182616 2007 Modulation of DRAK2 autophosphorylation by antigen receptor signaling in primary lymphocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11481038 2001 A serine/threonine kinase which causes apoptosis-like cell death interacts with a calcineurin B-like protein capable of binding Na(+)/H(+) exchanger.
9786912 1998 DRAKs, novel serine/threonine kinases related to death-associated protein kinase that trigger apoptosis.