Property Summary

Ligand Count 14
NCBI Gene PubMed Count 14
PubMed Score 10.44
PubTator Score 10.40

Knowledge Summary

Patent (2,327)

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.700 4.0e-04
aldosterone-producing adenoma -1.800 5.7e-03
astrocytoma 1.100 8.6e-10
Astrocytoma, Pilocytic 1.800 6.6e-07
Breast cancer -1.200 1.9e-06
Chronic Lymphocytic Leukemia -1.017 4.2e-02
cutaneous lupus erythematosus 1.700 2.5e-03
diabetes mellitus -1.200 2.5e-02
glioblastoma 2.100 3.1e-09
group 3 medulloblastoma 1.700 1.2e-02
hepatocellular carcinoma 1.200 9.1e-04
interstitial cystitis 1.800 9.5e-04
lung cancer -1.300 1.7e-02
lung carcinoma -2.000 8.6e-25
malignant mesothelioma -1.500 5.5e-07
Multiple myeloma 1.516 3.0e-02
oligodendroglioma 1.300 8.8e-10
osteosarcoma -2.711 3.7e-08
ovarian cancer 2.100 1.8e-04
primary Sjogren syndrome 2.400 5.7e-05
psoriasis 2.100 7.5e-04
tuberculosis -1.900 2.8e-07
Waldenstrons macroglobulinemia -1.328 4.3e-02

Gene RIF (8)

AA Sequence

MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRG      1 - 70
KFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEY     71 - 140
AAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGL    141 - 210
SRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNL    211 - 280
SYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVP    281 - 350
EINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY          351 - 414
//

Text Mined References (20)

PMID Year Title