Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.47
PubTator Score 10.40

Knowledge Summary

Patent (2,327)

Expression

  Differential Expression (23)

Disease log2 FC p
hepatocellular carcinoma 1.200 9.1e-04
Waldenstrons macroglobulinemia -1.328 4.3e-02
chronic lymphocytic leukemia -1.017 4.2e-02
Multiple myeloma 1.516 3.0e-02
malignant mesothelioma -1.500 5.5e-07
cutaneous lupus erythematosus 1.700 2.5e-03
psoriasis 2.100 7.5e-04
astrocytoma 1.100 8.6e-10
glioblastoma 3.400 2.0e-04
oligodendroglioma 1.300 8.8e-10
osteosarcoma -2.711 3.7e-08
tuberculosis and treatment for 3 months -2.000 1.9e-06
lung cancer -2.400 6.2e-03
diabetes mellitus -1.200 2.5e-02
interstitial cystitis 1.800 9.5e-04
pediatric high grade glioma 2.300 5.9e-07
group 3 medulloblastoma 1.700 1.2e-02
pilocytic astrocytoma 1.800 7.5e-07
primary Sjogren syndrome 2.400 5.7e-05
aldosterone-producing adenoma -1.800 5.7e-03
lung carcinoma -2.000 8.6e-25
Breast cancer -1.300 4.5e-17
ovarian cancer 2.100 1.8e-04

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (8)

PMID Text
26305096 the present study was the first to find localization of STK17A in normal bile canaliculi.
25531329 DRAK1 was predominantly localized in the cytoplasm and bound to Smad3, thereby interrupting Smad3/Smad4 complex formation, which is the core process for the induction of tumor suppressor genes by TGF-beta1
24312360 STK17A provides a proliferative and survival advantage to GBM cells
24162774 HIV-1 gp120 upregulates the expression of serine/threonine kinase 17a (STK17A) in human B cells
23860322 When analyzing STK17A haplotypes distribution, we found association between TGGTC, TAGTC and AAGAT haplotypes and risk to develop SLE
21489989 identified STK17A as a novel direct target of p53 and a modulator of cisplatin toxicity and reactive oxygen species in testicular cancer cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19730683 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRG      1 - 70
KFAVVRKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEY     71 - 140
AAGGEIFDQCVADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGL    141 - 210
SRILKNSEELREIMGTPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNL    211 - 280
SYSEEEFDVLSESAVDFIRTLLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVP    281 - 350
EINSDTDKSETKESIVTEELIVVTSYTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY          351 - 414
//

Text Mined References (20)

PMID Year Title
26305096 2015 Abnormal Localization of STK17A in Bile Canaliculi in Liver Allografts: An Early Sign of Chronic Rejection.
25531329 2015 Cytoplasmic DRAK1 overexpressed in head and neck cancers inhibits TGF-?1 tumor suppressor activity by binding to Smad3 to interrupt its complex formation with Smad4.
24312360 2013 Serine/threonine kinase 17A is a novel candidate for therapeutic targeting in glioblastoma.
23860322 2013 Polymorphisms in STK17A gene are associated with systemic lupus erythematosus and its clinical manifestations.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21802008 2011 High-throughput kinase profiling: a more efficient approach toward the discovery of new kinase inhibitors.
21489989 2011 Serine/threonine kinase 17A is a novel p53 target gene and modulator of cisplatin toxicity and reactive oxygen species in testicular cancer cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19369195 2009 Large-scale proteomics analysis of the human kinome.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15940259 2005 A p53-dominant transcriptional response to cisplatin in testicular germ cell tumor-derived human embryonal carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9786912 1998 DRAKs, novel serine/threonine kinases related to death-associated protein kinase that trigger apoptosis.