Property Summary

NCBI Gene PubMed Count 20
PubMed Score 72.24
PubTator Score 19.43

Knowledge Summary

Patent (3,613)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.600 9.9e-05
osteosarcoma -1.319 1.6e-04
lung cancer 1.300 1.9e-02
ovarian cancer 1.100 6.5e-09

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25084525 MAL2 and STK16 function to sort secretory soluble cargo into the constitutive secretory pathway in hepatocytes.
16310770 The Endogenous STK16 subcellular localization was evaluated by indirect immunofluorescence in NRK cells, demonstrating a Golgi-associated pattern that appears to be independent of signals provided by integrin pathways.

AA Sequence

MGHALCVCSRGTVIIDNKRYLFIQKLGEGGFSYVDLVEGLHDGHFYALKRILCHEQQDREEAQREADMHR      1 - 70
LFNHPNILRLVAYCLRERGAKHEAWLLLPFFKRGTLWNEIERLKDKGNFLTEDQILWLLLGICRGLEAIH     71 - 140
AKGYAHRDLKPTNILLGDEGQPVLMDLGSMNQACIHVEGSRQALTLQDWAAQRCTISYRAPELFSVQSHC    141 - 210
VIDERTDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSALRQLLNSMMTVDPHQR    211 - 280
PHIPLLLSQLEALQPPAPGQHTTQI                                                 281 - 305
//

Text Mined References (21)

PMID Year Title
25519916 2014 The EHEC-host interactome reveals novel targets for the translocated intimin receptor.
25416956 2014 A proteome-scale map of the human interactome network.
25084525 2014 Serine/threonine kinase 16 and MAL2 regulate constitutive secretion of soluble cargo in hepatic cells.
19060904 2009 An empirical framework for binary interactome mapping.
18184589 2008 Structure of the human protein kinase MPSK1 reveals an atypical activation loop architecture.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16310770 2006 Nucleocytoplasmic shuttling of STK16 (PKL12), a Golgi-resident serine/threonine kinase involved in VEGF expression regulation.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11741987 2002 Functional interaction between the Ser/Thr kinase PKL12 and N-acetylglucosamine kinase, a prominent enzyme implicated in the salvage pathway for GlcNAc recycling.
10947953 2000 A novel transcriptional factor with Ser/Thr kinase activity involved in the transforming growth factor (TGF)-beta signalling pathway.
10364453 1999 Identification and characterization of a myristylated and palmitylated serine/threonine protein kinase.
9712705 1998 Cloning, expression analysis, and functional characterization of PKL12, a member of a new subfamily of ser/thr kinases.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.