Property Summary

NCBI Gene PubMed Count 56
PubMed Score 103.60
PubTator Score 77.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
Rheumatoid Arthritis -1.800 1.2e-02
malignant mesothelioma 1.600 1.7e-07
psoriasis -3.100 1.8e-05
non-small cell lung cancer 1.411 8.5e-10
lung cancer 1.800 1.5e-05
colon cancer 1.100 1.7e-02
lung adenocarcinoma 1.587 5.5e-08
breast carcinoma 1.200 9.0e-14
invasive ductal carcinoma 1.600 2.9e-04
Gaucher disease type 1 -1.600 2.5e-02
dermatomyositis -1.200 1.2e-03

Protein-protein Interaction (6)

Gene RIF (29)

PMID Text
25311551 Stip1 has a role in the male reproductive system and is expressed during the stress response
25034945 Data confirmed the significant up-regulation of STIP1 in tumorous cholangiocytes relative to normal hepatocytes and non-tumorous cells and show prooved it as a reliable diagnostic biomarker when using immunohistochemistry.
25010044 STIP1 and moesin may be novel and differential sero-diagnostic markers for psoriasis vulgaris and psoriatic arthritis
24535459 These results indicate that HOP is a unique co-chaperone that undergoes an ATP-dependent conformational change.
24488757 Increased STIP1 expression is associated with poor survival outcome in epithelial ovarian cancer (EOC), and STIP1 may represent a useful therapeutic target in EOC patients.
24163084 our findings provide evidences that positive expression of STIP1 in papillary thyroid carcinoma may be important in the acquisition of an aggressive phenotype
23915849 STIP1 histoscores may be useful in detecting invasive human ovarian cancer in patients with low serum CA125 levels.
23836498 stress-inducible protein-1 has a role in recruitment of bone marrow derived cells into the ischemic brains
23166591 Expression of HIV-1 Tat upregulates the abundance of stress-induced-phosphoprotein 1 (STIP1) in the nucleoli of Jurkat T-cells
22884369 Luminal iron levels govern intestinal tumorigenesis after Apc loss in vivo.
22824801 results show phosphorylation of the C-terminal region of Hsp70 and Hsp90 is critical for the decision between folding or degradation of client proteins by altering the binding of CHIP and HOP; also show increased phosphorylation in cancer cells with increased levels of the co-chaperone HOP
22558459 HOP as a novel regulator of angiogenesis that functions through promoting vascular endothelial cell polarization and migration
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22174317 Expression of HIV-1 Tat upregulates the abundance of stress-induced-phosphoprotein 1 (STIP1) in the nucleoli of Jurkat T-cells
21875754 STIP-1 is an antigenic target in cultured hippocampal neurons in sera and/or cerebrospinal fluids of patients with neuro-Behcet's disease.
21784300 We found no genome-wide statistically significant associations but identified several plausible candidate genes among findings at p < 5E-05: STIP1, TMEM132D, LRRC7, SEMA3A, and ALK.
21470770 High STIP1 is associated with pancreatic Cancer.
21067243 This study has revealed that Rho GDP-dissociation inhibitor 2, Y-box binding protein 1, and the HSP70/90 organizing protein have a critical role to play in resistance to cyclin-depedent kinases inhibitor.
20501939 show that stress-induced phosphoprotein 1 (STIP1) was secreted by ovarian cancer tissues into the peripheral blood of patients, resulting in a significant increase of serum levels of STIP1 in cancer patients compared with those in normal controls
19961430 Presented: Hop-D456G, a Hop mutant within the TPR2B-domain, that is a mixture of monomeric and dimeric species, suggesting the TPR2B-domain may also play a role in dimerization.
19866486 Sedimentation equilibrium AUC clearly shows that HOP is a monomer, with no indication of higher MW species. An in vivo coexpression assay that also supports the conclusion that HOP is a monomer.
19254810 STIP1 genetic variations might play a role in regulating corticosteroid response in asthmatic subjects with reduced lung function.
19254810 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18976975 Knockdown of stress-induced-phosphoprotein 1 (STIP1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
18485364 It is likely that Hop binds to both monomers of Hsp90 in the form of a clamp, interacting with residues in the middle domain of Hsp90, preventing ATP hydrolysis, possibly by the preventing binding of N-terminal and middle domains in Hsp90 monomers.
18095154 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17886292 STI1 is secreted by and induces proliferation in glioma cells, an effect that is modulated by the Erk and PI3K pathways. STI1 does not induce proliferation of normal glia, in contrast to glioma cells.
15632128 Hsp70/Hsp90 organizing protein (Hop) coordinates Hsp70 and Hsp90 interactions during assembly of steroid receptor complexes.
11877417 TPR1 and TPR2A domains of the Hsp70/Hsp90 adapter protein p60/Hop specifically bind to short peptides corresponding to the C-terminal tails of Hsp70 and Hsp90

AA Sequence

MEQVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKGDYQKAYEDGCKTVDLKPD      1 - 70
WGKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNMPNLYQKLESD     71 - 140
PRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEEEIATPPPPPPPKKETK    141 - 210
PEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKELDPTNMTYITNQAAVYFEKGDYNKCRE    211 - 280
LCEKAIEVGRENREDYRQIAKAYARIGNSYFKEEKYKDAIHFYNKSLAEHRTPDVLKKCQQAEKILKEQE    281 - 350
RLAYINPDLALEEKNKGNECFQKGDYPQAMKHYTEAIKRNPKDAKLYSNRAACYTKLLEFQLALKDCEEC    351 - 420
IQLEPTFIKGYTRKAAALEAMKDYTKAMDVYQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAM    421 - 490
ADPEVQQIMSDPAMRLILEQMQKDPQALSEHLKNPVIAQKIQKLMDVGLIAIR                     491 - 543
//

Text Mined References (73)

PMID Year Title
27353360 2016 The FNIP co-chaperones decelerate the Hsp90 chaperone cycle and enhance drug binding.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25311551 2015 Systematic study of stress-inducible protein 1 (Stip1) in male reproductive system and its expression during stress response.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
25034945 2014 Identification of novel biomarker candidates for the immunohistochemical diagnosis of cholangiocellular carcinoma.
25010044 2014 Moesin and stress-induced phosphoprotein-1 are possible sero-diagnostic markers of psoriasis.
24880080 2014 SMYD2-dependent HSP90 methylation promotes cancer cell proliferation by regulating the chaperone complex formation.
24535459 2014 ATPase activity and ATP-dependent conformational change in the co-chaperone HSP70/HSP90-organizing protein (HOP).
24488757 2014 Expression of stress-induced phosphoprotein1 (STIP1) is associated with tumor progression and poor prognosis in epithelial ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163084 2014 Expression and clinical significance of STIP1 in papillary thyroid carcinoma.
23915849 2013 Immunohistological analysis of stress-induced phosphoprotein 1 in ovarian cancer patients with low serum cancer antigen 125 levels.
23836498 2013 Role of stress-inducible protein-1 in recruitment of bone marrow derived cells into the ischemic brains.
23431407 2013 Distinct roles of molecular chaperones HSP90? and HSP90? in the biogenesis of KCNQ4 channels.
23349634 2013 A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22884369 2012 Secreted stress-induced phosphoprotein 1 activates the ALK2-SMAD signaling pathways and promotes cell proliferation of ovarian cancer cells.
22824801 2013 C-terminal phosphorylation of Hsp70 and Hsp90 regulates alternate binding to co-chaperones CHIP and HOP to determine cellular protein folding/degradation balances.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22558459 2012 Regulation of vascular endothelial cell polarization and migration by Hsp70/Hsp90-organizing protein.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21875754 2011 Anti-neuronal and stress-induced-phosphoprotein 1 antibodies in neuro-Behçet's disease.
21784300 2011 Genome-wide association study of the child behavior checklist dysregulation profile.
21470770 2011 RNAi knockdown of Hop (Hsp70/Hsp90 organising protein) decreases invasion via MMP-2 down regulation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21067243 2011 Cancer drug-resistance and a look at specific proteins: Rho GDP-dissociation inhibitor 2, Y-box binding protein 1, and HSP70/90 organizing protein in proteomics clinical application.
21044950 2011 Genome-wide YFP fluorescence complementation screen identifies new regulators for telomere signaling in human cells.
20501939 2010 Stress-induced phosphoprotein 1 as a secreted biomarker for human ovarian cancer promotes cancer cell proliferation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20029029 2009 Regulation of epidermal growth factor receptor trafficking by lysine deacetylase HDAC6.
19961430 2010 Human Hsp70/Hsp90 organizing protein (Hop) D456G is a mixture of monomeric and dimeric species.
19866486 2010 HOP is a monomer: investigation of the oligomeric state of the co-chaperone HOP.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19254810 2009 The glucocorticoid receptor heterocomplex gene STIP1 is associated with improved lung function in asthmatic subjects treated with inhaled corticosteroids.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18485364 2008 Structural studies on the co-chaperone Hop and its complexes with Hsp90.
18095154 2008 Use of expression data and the CGEMS genome-wide breast cancer association study to identify genes that may modify risk in BRCA1/2 mutation carriers.
17886292 2007 STI1 promotes glioma proliferation through MAPK and PI3K pathways.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16916647 2006 Substrate and functional diversity of lysine acetylation revealed by a proteomics survey.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16130169 2005 Proteomics of human umbilical vein endothelial cells applied to etoposide-induced apoptosis.
16100115 2005 Independent regulation of Hsp70 and Hsp90 chaperones by Hsp70/Hsp90-organizing protein Sti1 (Hop1).
15632128 2005 Functional comparison of human and Drosophila Hop reveals novel role in steroid receptor maturation.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14754904 2004 Nuclear translocation of the Hsp70/Hsp90 organizing protein mSTI1 is regulated by cell cycle kinases.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14532270 2003 A product of the human gene adjacent to parkin is a component of Lewy bodies and suppresses Pael receptor-induced cell death.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437126 2002 The Hsp90 co-chaperones Cdc37 and Sti1 interact physically and genetically.
12161444 2002 The assembly and intermolecular properties of the hsp70-Hop-hsp90 molecular chaperone complex.
12093732 2002 Stress-inducible protein 1 is a cell surface ligand for cellular prion that triggers neuroprotection.
11809754 2002 HSP40 binding is the first step in the HSP90 chaperoning pathway for the progesterone receptor.
10786835 2000 Structure of TPR domain-peptide complexes: critical elements in the assembly of the Hsp70-Hsp90 multichaperone machine.
10508479 1999 Antigens recognized by autologous antibody in patients with renal-cell carcinoma.
9727490 1998 Repression of heat shock transcription factor HSF1 activation by HSP90 (HSP90 complex) that forms a stress-sensitive complex with HSF1.
9261129 1997 Folding of the glucocorticoid receptor by the heat shock protein (hsp) 90-based chaperone machinery. The role of p23 is to stabilize receptor.hsp90 heterocomplexes formed by hsp90.p60.hsp70.
9195923 1997 Protein phosphatase 5 is a major component of glucocorticoid receptor.hsp90 complexes with properties of an FK506-binding immunophilin.
9148915 1997 Folding of the glucocorticoid receptor by the reconstituted Hsp90-based chaperone machinery. The initial hsp90.p60.hsp70-dependent step is sufficient for creating the steroid binding conformation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
1569099 1992 Molecular cloning and expression of a transformation-sensitive human protein containing the TPR motif and sharing identity to the stress-inducible yeast protein STI1.
1286667 1992 Microsequences of 145 proteins recorded in the two-dimensional gel protein database of normal human epidermal keratinocytes.