Property Summary

NCBI Gene PubMed Count 49
PubMed Score 70.20
PubTator Score 50.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Weight Gain 100 0.0 0.0
Disease Target Count P-value
Breast cancer 3578 6.6e-24
ovarian cancer 8520 9.8e-12
intraductal papillary-mucinous carcinoma (IPMC) 2989 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.200 6.6e-24
intraductal papillary-mucinous carcinoma... 1.100 1.4e-02
ovarian cancer -1.400 9.8e-12

Gene RIF (36)

AA Sequence

MLVLGLLVAGAADGCELVPRHLRGRRATGSAATAASSPAAAAGDSPALMTDPCMSLSPPCFTEEDRFSLE      1 - 70
ALQTIHKQMDDDKDGGIEVEESDEFIREDMKYKDATNKHSHLHREDKHITIEDLWKRWKTSEVHNWTLED     71 - 140
TLQWLIEFVELPQYEKNFRDNNVKGTTLPRIAVHEPSFMISQLKISDRSHRQKLQLKALDVVLFGPLTRP    141 - 210
PHNWMKDFILTVSIVIGVGGCWFAYTQNKTSKEHVAKMMKDLESLQTAEQSLMDLQERLEKAQEENRNVA    211 - 280
VEKQNLERKMMDEINYAKEEACRLRELREGAECELSRRQYAEQELEQVRMALKKAEKEFELRSSWSVPDA    281 - 350
LQKWLQLTHEVEVQYYNIKRQNAEMQLAIAKDEAEKIKKKRSTVFGTLHVAHSSSLDEVDHKILEAKKAL    351 - 420
SELTTCLRERLFRWQQIEKICGFQIAHNSGLPSLTSSLYSDHSWVVMPRVSIPPYPIAGGVDDLDEDTPP    421 - 490
IVSQFPGTMAKPPGSLARSSSLCRSRRSIVPSSPQPQRAQLAPHAPHPSHPRHPHHPQHTPHSLPSPDPD    491 - 560
ILSVSSCPALYRNEEEEEAIYFSAEKQWEVPDTASECDSLNSSIGRKQSPPLSLEIYQTLSPRKISRDEV    561 - 630
SLEDSSRGDSPVTVDVSWGSPDCVGLTETKSMIFSPASKVYNGILEKSCSMNQLSSGIPVPKPRHTSCSS    631 - 700
AGNDSKPVQEAPSVARISSIPHDLCHNGEKSKKPSKIKSLFKKKSK                            701 - 746
//

Text Mined References (54)

PMID Year Title