Property Summary

NCBI Gene PubMed Count 48
PubMed Score 86.08
PubTator Score 516.36

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26549353 data provide evidence for novel functions of the human oncogene Stil in neural toxic susceptibility.
26188084 The authors suggest that the STIL-coiled-coil region/PLK4 interaction mediates PLK4 activation as well as stabilization of centriolar PLK4 and plays a key role in centriole duplication.
25658757 The STIL p.Gly717Glu mutation was not able to fully restore the centriole duplication failure following depletion of endogenous STIL protein indicating the deleterious role of the mutation.
25342035 Negative feedback by centriolar STIL regulates bimodal centriolar distribution of Plk4 and seemingly restricts occurrence of procentriole formation to one site on each parental centriole.
25218063 STIL mutation causes autosomal recessive microcephalic lobar holoprosencephaly.
24853807 results provide direct evidence for the involvement of Stil in dopaminergic cell proliferation
24571118 Egyptian T-cell acute lymphoblastic leukemia cases seemed to have a different genetic pattern compared to other populations, with a lower incidence of TLX3/HOX11L2 and SIL/TAL but a higher incidence of NKX2-5 expression than recorded in Western countries
24485834 propose that centriole amplification triggered by STIL stabilization is the underlying cause of microcephaly in human patients with corresponding STIL mutations
24240054 A novel function for Stil protein is neural progenitor cell proliferation but not neural differentiation.
24052813 studies provide the first structural insight into how the malfunction of centriole proteins results in human disease and also reveal that the CPAP-STIL interaction constitutes a conserved key step in centriole biogenesis
22989186 Identification of a novel STIL mutation in a family with primary microcephaly.
22349705 These findings demonstrate that STIL is an essential component of the centriole replication machinery in mammalian cells.
22349698 STIL cooperates with SAS-6 and PLK4 in the control of centriole number and represents a key centriole duplication factor in human cells.
22100914 STIL and CPAP are essential for centriole formation and for proper spindle position.
22020124 STIL depletion inhibited normal centriole duplication, Plk4-induced centriole amplification, and CPAP-induced centriole elongation, and resulted in a failure to localize hSAS6 and CPAP to the base of the nascent procentriole.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19215732 Primary microcephaly is an autosomal-recessive congenital disorder characterized by smaller brain size and mental retardation, in which homozygote mutations in STIL proteins are found.
18829525 A role ofor SIL in derepressing GLI1 from the negative control of SUFU.
18187418 LMO2, TAL1, Ttg-1, and SIL support levels of V(D)J recombination above background levels in cell culture and are also cleaved by the RAG proteins, while Hox11 and SCL are nicked but not cleaved efficiently in vitro
17576815 These data, taken together, identify SIL as a novel, vertebrate-specific regulator of mitotic spindle assembly.
17460775 Mice carrying both SILloxloxSCL and Cre transgenes have increased CD4-negative/CD8-negative thymocytes compared with transgene-negative mice.
17456584 SIL is important for the transition from the G(2) to the M phases of the cell cycle. Inducible knockdown of SIL in cancer cells in vitro delayed entrance into mitosis, decreased activation of the CDK1 (CDC2)-cyclin B complex, and induced apoptosis.
16024801 Cell cycle-dependent phosphorylation of Sil is required for its interaction with Pin1, a regulator of mitosis.
15107824 Sil has a role in increased mitotic activity in tumor cells
14504110 Children with t-cell malignancies and with SIL-TAL fusion had low levels of residual disease at the end of induction and a favorable prognosis
12531481 isolation and characterization of a cloned promoter as well as its role in leukemogenesis
12438740 dHPLC techniques were used to screen for mutations and these studies identified several common polymorphisms but no disease-associated mutations, suggesting that SIL is not a common factor in holoprosencephaly pathogenesis in humans.

AA Sequence

MEPIYPFARPQMNTRFPSSRMVPFHFPPSKCALWNPTPTGDFIYLHLSYYRNPKLVVTEKTIRLAYRHAK      1 - 70
QNKKNSSCFLLGSLTADEDEEGVTLTVDRFDPGREVPECLEITPTASLPGDFLIPCKVHTQELCSREMIV     71 - 140
HSVDDFSSALKALQCHICSKDSLDCGKLLSLRVHITSRESLDSVEFDLHWAAVTLANNFKCTPVKPIPII    141 - 210
PTALARNLSSNLNISQVQGTYKYGYLTMDETRKLLLLLESDPKVYSLPLVGIWLSGITHIYSPQVWACCL    211 - 280
RYIFNSSVQERVFSESGNFIIVLYSMTHKEPEFYECFPCDGKIPDFRFQLLTSKETLHLFKNVEPPDKNP    281 - 350
IRCELSAESQNAETEFFSKASKNFSIKRSSQKLSSGKMPIHDHDSGVEDEDFSPRPIPSPHPVSQKISKI    351 - 420
QPSVPELSLVLDGNFIESNPLPTPLEMVNNENPPLINHLEHLKPLQPQLYDEKHSPEVEAGEPSLRGIPN    421 - 490
QLNQDKPALLRHCKVRQPPAYKKGNPHTRNSIKPSSHNGPSHDIFEKLQTVSAGNVQNEEYPIRPSTLNS    491 - 560
RQSSLAPQSQPHDFVFSPHNSGRPMELQIPTPPLPSYCSTNVCRCCQHHSHIQYSPLNSWQGANTVGSIQ    561 - 630
DVQSEALQKHSLFHPSGCPALYCNAFCSSSSPIALRPQGDMGSCSPHSNIEPSPVARPPSHMDLCNPQPC    631 - 700
TVCMHTPKTESDNGMMGLSPDAYRFLTEQDRQLRLLQAQIQRLLEAQSLMPCSPKTTAVEDTVQAGRQME    701 - 770
LVSVEAQSSPGLHMRKGVSIAVSTGASLFWNAAGEDQEPDSQMKQDDTKISSEDMNFSVDINNEVTSLPG    771 - 840
SASSLKAVDIPSFEESNIAVEEEFNQPLSVSNSSLVVRKEPDVPVFFPSGQLAESVSMCLQTGPTGGASN    841 - 910
NSETSEEPKIEHVMQPLLHQPSDNQKIYQDLLGQVNHLLNSSSKETEQPSTKAVIISHECTRTQNVYHTK    911 - 980
KKTHHSRLVDKDCVLNATLKQLRSLGVKIDSPTKVKKNAHNVDHASVLACISPEAVISGLNCMSFANVGM    981 - 1050
SGLSPNGVDLSMEANAIALKYLNENQLSQLSVTRSNQNNCDPFSLLHINTDRSTVGLSLISPNNMSFATK   1051 - 1120
KYMKRYGLLQSSDNSEDEEEPPDNADSKSEYLLNQNLRSIPEQLGGQKEPSKNDHEIINCSNCESVGTNA   1121 - 1190
DTPVLRNITNEVLQTKAKQQLTEKPAFLVKNLKPSPAVNLRTGKAEFTQHPEKENEGDITIFPESLQPSE   1191 - 1260
TLKQMNSMNSVGTFLDVKRLRQLPKLF                                              1261 - 1287
//

Text Mined References (52)

PMID Year Title
26638075 2015 A Dynamic Protein Interaction Landscape of the Human Centrosome-Cilium Interface.
26549353 2015 A novel function of the human oncogene Stil: Regulation of PC12 cell toxic susceptibility through the Shh pathway.
26188084 2015 STIL binding to Polo-box 3 of PLK4 regulates centriole duplication.
25658757 2015 Homozygous STIL mutation causes holoprosencephaly and microcephaly in two siblings.
25385835 2015 RBM14 prevents assembly of centriolar protein complexes and maintains mitotic spindle integrity.
25342035 2014 Direct interaction of Plk4 with STIL ensures formation of a single procentriole per parental centriole.
25218063 2015 STIL mutation causes autosomal recessive microcephalic lobar holoprosencephaly.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24853807 2014 Characterization of the human oncogene SCL/TAL1 interrupting locus (Stil) mediated Sonic hedgehog (Shh) signaling transduction in proliferating mammalian dopaminergic neurons.
24571118 2016 NKX2-5, SIL/TAL and TLX3/HOX11L2 expression in Egyptian pediatric T-cell acute lymphoblastic leukemia.
24485834 2014 STIL microcephaly mutations interfere with APC/C-mediated degradation and cause centriole amplification.
24240054 2014 The human oncogene SCL/TAL1 interrupting locus is required for mammalian dopaminergic cell proliferation through the Sonic hedgehog pathway.
24052813 2013 Crystal structures of the CPAP/STIL complex reveal its role in centriole assembly and human microcephaly.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22989186 2013 Investigation of primary microcephaly in Bushehr province of Iran: novel STIL and ASPM mutations.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22349705 2012 STIL is required for centriole duplication in human cells.
22349698 2012 Cell-cycle-regulated expression of STIL controls centriole number in human cells.
22100914 2011 Spindle positioning in human cells relies on proper centriole formation and on the microcephaly proteins CPAP and STIL.
22020124 2011 The human microcephaly protein STIL interacts with CPAP and is required for procentriole formation.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19215732 2009 Mutations in STIL, encoding a pericentriolar and centrosomal protein, cause primary microcephaly.
18829525 2008 SCL/TAL1 interrupting locus derepresses GLI1 from the negative control of suppressor-of-fused in pancreatic cancer cell.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18187418 2008 V(D)J recombinase binding and cleavage of cryptic recombination signal sequences identified from lymphoid malignancies.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17576815 2007 The zebra fish cassiopeia mutant reveals that SIL is required for mitotic spindle organization.
17460775 2007 Cre-loxP-mediated recombination between the SIL and SCL genes leads to a block in T-cell development at the CD4- CD8- to CD4+ CD8+ transition.
17456584 2007 The SIL gene is essential for mitotic entry and survival of cancer cells.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16024801 2005 Sil phosphorylation in a Pin1 binding domain affects the duration of the spindle checkpoint.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15107824 2004 Sil overexpression in lung cancer characterizes tumors with increased mitotic activity.
14504110 2004 Clinical significance of HOX11L2 expression linked to t(5;14)(q35;q32), of HOX11 expression, and of SIL-TAL fusion in childhood T-cell malignancies: results of EORTC studies 58881 and 58951.
12681356 2003 Measurement of SIL-TAL1 fusion gene transcripts associated with human T-cell lymphocytic leukemia by real-time reverse transcriptase-PCR.
12531481 2003 Cloning and characterization of the SIL promoter.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438740 2002 The genomic structure, chromosomal localization, and analysis of SIL as a candidate gene for holoprosencephaly.
12199779 2002 Molecular characterization of a new recombination of the SIL/TAL-1 locus in a child with T-cell acute lymphoblastic leukaemia.
11390401 2001 Analysis of the V(D)J recombination efficiency at lymphoid chromosomal translocation breakpoints.
10657125 2000 Analysis of vertebrate SCL loci identifies conserved enhancers.
9372240 1997 Expression of the SIL gene is correlated with growth induction and cellular proliferation.
8825637 1995 Cloning and characterization of a murine SIL gene.
8321044 1993 Clinical significance of TAL1 gene alteration in childhood T-cell acute lymphoblastic leukemia and lymphoma.
2255914 1990 Disruption of the human SCL locus by "illegitimate" V-(D)-J recombinase activity.
2209547 1990 Site-specific recombination of the tal-1 gene is a common occurrence in human T cell leukemia.
2040693 1991 Rearrangements of the tal-1 locus as clonal markers for T cell acute lymphoblastic leukemia.
1922059 1991 Structural characterization of SIL, a gene frequently disrupted in T-cell acute lymphoblastic leukemia.
1311214 1992 Involvement of the putative hematopoietic transcription factor SCL in T-cell acute lymphoblastic leukemia.