Property Summary

NCBI Gene PubMed Count 13
PubMed Score 56.55
PubTator Score 13.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -1.800 1.6e-05
astrocytic glioma -2.100 1.1e-03
atypical teratoid / rhabdoid tumor -2.100 2.8e-07
cystic fibrosis 2.431 1.6e-06
ependymoma -2.800 1.7e-03
glioblastoma -1.400 6.6e-05
group 3 medulloblastoma -2.800 1.1e-05
interstitial cystitis -1.600 2.6e-03
intraductal papillary-mucinous adenoma (... 1.200 4.4e-02
invasive ductal carcinoma -1.400 4.5e-02
lung adenocarcinoma 1.400 9.4e-05
medulloblastoma, large-cell -2.600 1.1e-05
oligodendroglioma -2.000 1.3e-02
ovarian cancer 1.400 3.0e-03
Pick disease -1.100 1.5e-02
primitive neuroectodermal tumor -2.000 4.3e-03
subependymal giant cell astrocytoma -1.979 3.2e-02
urothelial carcinoma -2.200 4.4e-02

Gene RIF (8)

AA Sequence

MESISMMGSPKSLSETFLPNGINGIKDARKVTVGVIGSGDFAKSLTIRLIRCGYHVVIGSRNPKFASEFF      1 - 70
PHVVDVTHHEDALTKTNIIFVAIHREHYTSLWDLRHLLVGKILIDVSNNMRINQYPESNAEYLASLFPDS     71 - 140
LIVKGFNVVSAWALQLGPKDASRQVYICSNNIQARQQVIELARQLNFIPIDLGSLSSAREIENLPLRLFT    141 - 210
LWRGPVVVAISLATFFFLYSFVRDVIHPYARNQQSDFYKIPIEIVNKTLPIVAITLLSLVYLAGLLAAAY    211 - 280
QLYYGTKYRRFPPWLETWLQCRKQLGLLSFFFAMVHVAYSLCLPMRRSERYLFLNMAYQQVHANIENSWN    281 - 350
EEEVWRIEMYISFGIMSLGLLSLLAVTSIPSVSNALNWREFSFIQSTLGYVALLISTFHVLIYGWKRAFE    351 - 420
EEYYRFYTPPNFVLALVLPSIVILGKIILFLPCISRKLKRIKKGWEKSQFLEEGMGGTIPHVSPERVTVM    421 - 490
//

Text Mined References (16)

PMID Year Title