Property Summary

NCBI Gene PubMed Count 25
PubMed Score 43.90
PubTator Score 35.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
malignant mesothelioma -6.100 1.1e-09
astrocytic glioma -1.100 9.8e-03
ependymoma -1.400 8.6e-03
oligodendroglioma -1.200 7.2e-03
esophageal adenocarcinoma 1.200 4.6e-02
osteosarcoma 2.457 1.7e-03
glioblastoma 1.900 2.6e-03
cystic fibrosis 4.068 2.4e-08
atypical teratoid/rhabdoid tumor 1.600 1.5e-04
Atopic dermatitis -1.300 2.7e-03
non-small cell lung cancer 2.293 1.7e-15
intraductal papillary-mucinous adenoma (... 1.800 1.9e-02
intraductal papillary-mucinous neoplasm ... 2.800 1.4e-02
pancreatic cancer 1.300 1.4e-03
lung adenocarcinoma 1.600 4.6e-04
pediatric high grade glioma 1.900 3.3e-04
gastric carcinoma 2.400 4.6e-02
ductal carcinoma in situ -1.100 2.9e-02
ovarian cancer 2.800 2.9e-04

Gene RIF (16)

PMID Text
25453051 These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression
24239460 Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions.
24025158 The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients.
23060075 STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate.
22317770 A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane.
22317770 STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics.
22080479 STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1.
22080479 EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells.
21928126 Studies suggest that activated human gammadelta T cells can efficiently present PRAME and STEAP1-derived epitopes and allow breaking tolerance against these tumor-associated self-antigens.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
19915386 Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP.
19196137 STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18958632 STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol.
18793824 STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options.
15958640 Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine.

AA Sequence

MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQ      1 - 70
WHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQ     71 - 140
LHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIE    141 - 210
HDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDI    211 - 280
KQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQL               281 - 339
//

Text Mined References (26)

PMID Year Title
25453051 2014 Annotating STEAP1 regulation in prostate cancer with 89Zr immuno-PET.
24239460 2014 STEAP1 is overexpressed in prostate cancer and prostatic intraepithelial neoplasia lesions, and it is positively associated with Gleason score.
24025158 2013 STEAP1 protein overexpression is an independent marker for biochemical recurrence in prostate carcinoma.
23870195 2013 Genetics of coronary artery calcification among African Americans, a meta-analysis.
23060075 2013 Six transmembrane epithelial antigen of the prostate 1 is down-regulated by sex hormones in prostate cells.
22317770 2012 High STEAP1 expression is associated with improved outcome of Ewing's sarcoma patients.
22080479 2012 STEAP1 is associated with the invasive and oxidative stress phenotype of Ewing tumors.
21928126 2012 Activated human ?? T cells induce peptide-specific CD8+ T-cell responses to tumor-associated self-antigens.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
19946888 2010 Defining the membrane proteome of NK cells.
19915386 2010 Zoledronic acid decreases mRNA six-transmembrane epithelial antigen of prostate protein expression in prostate cancer cells.
19196137 2009 Six-transmembrane epithelial antigen of the prostate (STEAP1 and STEAP2)-differentially expressed by murine and human mesenchymal stem cells.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18958632 STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol in MCF-7 cells and in the rat mammary gland.
18793824 2009 STEAP mRNA detection in serum of patients with solid tumours.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16609065 2006 The Steap proteins are metalloreductases.
15958640 2005 Recognition of six-transmembrane epithelial antigen of the prostate-expressing tumor cells by peptide antigen-induced cytotoxic T lymphocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12095985 2002 Molecular cloning and characterization of STAMP1, a highly prostate-specific six transmembrane protein that is overexpressed in prostate cancer.
11479226 2001 Murine six-transmembrane epithelial antigen of the prostate, prostate stem cell antigen, and prostate-specific membrane antigen: prostate-specific cell-surface antigens highly expressed in prostate cancer of transgenic adenocarcinoma mouse prostate mice.
10588738 1999 STEAP: a prostate-specific cell-surface antigen highly expressed in human prostate tumors.
9847074 1998 Toward a complete human genome sequence.