Property Summary

NCBI Gene PubMed Count 18
PubMed Score 18.82
PubTator Score 9.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma -1.700 1.1e-03
ependymoma -2.000 4.5e-03
oligodendroglioma -1.500 6.7e-03
glioblastoma -2.200 1.6e-06
osteosarcoma -2.722 2.9e-07
medulloblastoma -2.200 7.0e-07
atypical teratoid / rhabdoid tumor -2.400 2.2e-09
medulloblastoma, large-cell -2.600 8.4e-05
primitive neuroectodermal tumor -1.600 9.0e-05
lung cancer 1.200 6.7e-04
pediatric high grade glioma -1.700 7.4e-07
pilocytic astrocytoma -1.600 2.9e-07
non primary Sjogren syndrome sicca -1.100 2.9e-02
invasive ductal carcinoma 1.200 1.4e-02
ovarian cancer 1.200 1.4e-02

 GO Process (1)

Gene RIF (7)

PMID Text
24520823 Authors establish that human Staufen-2, a host factor which is up-regulated upon HIV-1 infection, interacts with HIV-1 Rev, thereby promoting its RNA export activity and progeny virus formation.
24520823 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
23263869 Staufen2 functions in Staufen1-mediated mRNA decay by binding to itself and its paralog and promoting UPF1 helicase but not ATPase activity.
21508097 We suggest a role for Stau2 in the generation and regulation of Map1b mRNA containing granules that are required for mGluR-long-term depression
18094122 Stau1- and Stau2-mRNPs associate with distinct but overlapping sets of cellular mRNAs.
15024055 Human STAU-2 increases HIV-1 production with upregulated levels of HIV-1 CA
12140260 Data show that Stau2 is localized to the neuronal soma and dendrites, but it does not colocalize with Stau1-containing particles.

AA Sequence

MANPKEKTAMCLVNELARFNRVQPQYKLLNERGPAHSKMFSVQLSLGEQTWESEGSSIKKAQQAVANKAL      1 - 70
TESTLPKPVQKPPKSNVNNNPGSITPTVELNGLAMKRGEPAIYRPLDPKPFPNYRANYNFRGMYNQRYHC     71 - 140
PVPKIFYVQLTVGNNEFFGEGKTRQAARHNAAMKALQALQNEPIPERSPQNGESGKDMDDDKDANKSEIS    141 - 210
LVFEIALKRNMPVSFEVIKESGPPHMKSFVTRVSVGEFSAEGEGNSKKLSKKRAATTVLQELKKLPPLPV    211 - 280
VEKPKLFFKKRPKTIVKAGPEYGQGMNPISRLAQIQQAKKEKEPDYVLLSERGMPRRREFVMQVKVGNEV    281 - 350
ATGTGPNKKIAKKNAAEAMLLQLGYKASTNLQDQLEKTGENKGWSGPKPGFPEPTNNTPKGILHLSPDVY    351 - 420
QEMEASRHKVISGTTLGYLSPKDMNQPSSSFFSISPTSNSSATIARELLMNGTSSTAEAIGLKGSSPTPP    421 - 490
CSPVQPSKQLEYLARIQGFQAALSALKQFSEQGLDPIDGAMNIEKGSLEKQAKHLREKADNNQAPPGSIA    491 - 560
QDCKKSNSAV                                                                561 - 570
//

Text Mined References (30)

PMID Year Title
24520823 2014 Human protein Staufen-2 promotes HIV-1 proliferation by positively regulating RNA export activity of viral protein Rev.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
23263869 2013 Staufen2 functions in Staufen1-mediated mRNA decay by binding to itself and its paralog and promoting UPF1 helicase but not ATPase activity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21508097 2011 Staufen 2 regulates mGluR long-term depression and Map1b mRNA distribution in hippocampal neurons.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18094122 2008 A genome-wide approach identifies distinct but overlapping subsets of cellular mRNAs associated with Staufen1- and Staufen2-containing ribonucleoprotein complexes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12140260 2002 Staufen2 isoforms localize to the somatodendritic domain of neurons and interact with different organelles.
10707969 2000 Molecular insights into mRNA transport and local translation in the mammalian nervous system.
10585778 1999 Identification of a novel homolog of the Drosophila staufen protein in the chromosome 8q13-q21.1 region.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.