Property Summary

NCBI Gene PubMed Count 59
PubMed Score 169.18
PubTator Score 48.43

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 1.269 2.2e-03
osteosarcoma -1.063 1.9e-04
juvenile dermatomyositis 1.027 1.7e-10
intraductal papillary-mucinous neoplasm ... 1.400 1.1e-02
lung adenocarcinoma 1.319 5.9e-09
ovarian cancer 2.900 2.8e-06
dermatomyositis 1.300 2.7e-04

Gene RIF (43)

PMID Text
26824521 together, these data highlight the broad impact of Stau1 as a splicing regulator and suggest that Stau1 may act as a disease modifier in DM1.
25799984 in vivo atlas of mRNA secondary structures recognized by Staufen 1
25749978 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
25620022 The changing pattern of STAU distribution during meiotic maturation of human oocytes implicates a novel mechanism for the regulation of protein synthesis based on mRNA localization
25423178 expression of human Staufen1 is essential for proper dendritic arborisation during neuroblastoma cell differentiation, yet it is not necessary for maintenance of differentiated state, and suggest potential human Stauf1 mRNA targets involved in the process
25066606 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
25010285 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
24470147 A common sequence signature consisting of two opposite-polarity Alu motifs was present in the hStau1-associated mRNAs and was shown to be sufficient for binding to hStau1 and hStau1-dependent stimulation of protein expression.
24056942 STAU1 binding to a 3'-UTR SBS was previously shown to trigger STAU1-mediated mRNA decay (SMD) by directly recruiting the ATP-dependent RNA helicase UPF1
24019000 TINCR, together with Staufen1, seems to stabilize a subset of mRNAs required for epidermal differentiation.
23926355 These results suggest a new role for Staufen-1 as a cellular Rec and human endogenous retrovirus family HERV-K Gag cofactor.
23907398 Staufen1 is an important factor in HCV replication and it might play a role early in the HCV replication cycle, rather than virion morphogenesis.
23824540 STAU1 binding to 3' UTR IRAlus functions along with 3' UTR IRAlus-mediated nuclear retention to suppress the shutdown of cellular translation triggered by PKR binding to endogenous cytoplasmic dsRNAs
23722113 The regulation of STAU1 mediated mRNA decay efficiency by NS1 may contribute to building a more favorable cellular environment for viral replication.
23524536 SSM-mediated hSTAU1 dimerization increases the efficiency of SMD by augmenting hSTAU1 binding to the ATP-dependent RNA helicase hUPF1
23395680 this study reports the identification of two new hGIP-interacting partners, DTX1 and STAU1.
23305486 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
23125841 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
22978549 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
22584570 TDP-43 is physically associated with fragile X mental retardation protein (FMRP) and Staufen (STAU1) to form a functional complex.
22503102 For Stau1-mediated mRNA decay, Stau1 binds to the 3' untranslated region of target mRNA and recruits Upf1 to elicit rapid mRNA degradation.
22431750 our results unravel a novel function for Staufen1 in splicing regulation and indicate that it may positively modulate the complex DM1 phenotype
21945618 the specific region responsible for the interaction between Stau1 and influenza A Virus NS1 was identified.
21307942 findings that the binding of STAU1 to mRNAs can be transactivated by long non-coding RNAs uncovers an unexpected strategy that cells use to recruit proteins to mRNAs and mediate the decay of these mRNAs
20504931 These results indicate a role for hStau1 in late events of the influenza virus infection, possibly during virus morphogenesis.
20459747 Gag specifically recruited Staufen1 to the detergent insoluble membranes supporting a key function for this host factor during virus assembly.
20459747 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
20075165 The oligomeric composition of Stau1-containing complexes and the presence of specific mRNAs have been confirmed by biochemical approaches involving two successive immunoprecipitations of Stau1-tagged molecules followed by qRT-PCR amplification.
20053637 Work provides new evidence that Staufen1-containing HIV-1 RNPs preferentially form over other cellular silencing foci and are involved in assembly, localization and encapsidation of vRNA.
20053637 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
18806890 isolated a novel transcript of STAU1, coding a novel isoform that has six amino acids more (SFPLKQ) than isoform a
18508616 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
18498651 12 amino acids at the N-terminal end of Stau1 is necessary to increase Pr55Gag multimerization and particle release.
18498651 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
18094122 Stau1- and Stau2-mRNPs associate with distinct but overlapping sets of cellular mRNAs.
17510634 Stau1 influences the expression of a wide variety of physiologic transcripts and metabolic pathways.
17428849 Stau1 influences HIV-1 assembly by modulating pr55Gag-pr55Gag interactions, as shown in a live cell interaction assay
17428849 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
15121898 The identity of proteins present in staufen complexes from RNA granules indicates that staufen has a role in transport and translation of messenger RNAs.
15024055 These data show that Staufen, pr55(Gag), and genomic RNA are part of the same intracellular complex and support a role for Staufen in pr55(Gag) function in viral assembly, genomic RNA encapsidation, and the generation of infectious viral particles.
15024055 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag
12133005 Data show that the Staufen isoform Stau(55)co-fractionates with ribosomes, suggesting that it plays some role in translation.
10823848 Staufen is incorporated into HIV-1 virions through association with HIV-1 genomic RNA and is implicated in HIV-1 genome selection and packaging into assembling virions, a process that is mediated by the Nucleocapsid domain of HIV-1 Gag

AA Sequence

MSQVQVQVQNPSAALSGSQILNKNQSLLSQPLMSIPSTTSSLPSENAGRPIQNSALPSASITSTSAAAES      1 - 70
ITPTVELNALCMKLGKKPMYKPVDPYSRMQSTYNYNMRGGAYPPRYFYPFPVPPLLYQVELSVGGQQFNG     71 - 140
KGKTRQAAKHDAAAKALRILQNEPLPERLEVNGRESEEENLNKSEISQVFEIALKRNLPVNFEVARESGP    141 - 210
PHMKNFVTKVSVGEFVGEGEGKSKKISKKNAAIAVLEELKKLPPLPAVERVKPRIKKKTKPIVKPQTSPE    211 - 280
YGQGINPISRLAQIQQAKKEKEPEYTLLTERGLPRRREFVMQVKVGNHTAEGTGTNKKVAKRNAAENMLE    281 - 350
ILGFKVPQAQPTKPALKSEEKTPIKKPGDGRKVTFFEPGSGDENGTSNKEDEFRMPYLSHQQLPAGILPM    351 - 420
VPEVAQAVGVSQGHHTKDFTRAAPNPAKATVTAMIARELLYGGTSPTAETILKNNISSGHVPHGPLTRPS    421 - 490
EQLDYLSRVQGFQVEYKDFPKNNKNEFVSLINCSSQPPLISHGIGKDVESCHDMAALNILKLLSELDQQS    491 - 560
TEMPRTGNGPMSVCGRC                                                         561 - 577
//

Text Mined References (65)

PMID Year Title
26824521 2016 Staufen1 Regulates Multiple Alternative Splicing Events either Positively or Negatively in DM1 Indicating Its Role as a Disease Modifier.
25799984 2015 hiCLIP reveals the in vivo atlas of mRNA secondary structures recognized by Staufen 1.
25620022 2015 Expression and intracytoplasmic distribution of staufen and calreticulin in maturing human oocytes.
25423178 2014 Human Staufen1 associates to miRNAs involved in neuronal cell differentiation and is required for correct dendritic formation.
25416956 2014 A proteome-scale map of the human interactome network.
24489884 2014 Genome-wide association study of proneness to anger.
24470147 2014 Functional signature for the recognition of specific target mRNAs by human Staufen1 protein.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
24056942 2013 mRNA-mRNA duplexes that autoelicit Staufen1-mediated mRNA decay.
24019000 2013 TINCR, staufen1, and cellular differentiation.
23926355 2013 Staufen-1 interacts with the human endogenous retrovirus family HERV-K(HML-2) rec and gag proteins and increases virion production.
23907398 2013 A host cell RNA-binding protein, Staufen1, has a role in hepatitis C virus replication before virus assembly.
23853584 2013 The interactomes of influenza virus NS1 and NS2 proteins identify new host factors and provide insights for ADAR1 playing a supportive role in virus replication.
23824540 2013 STAU1 binding 3' UTR IRAlus complements nuclear retention to protect cells from PKR-mediated translational shutdown.
23722113 2013 Non-structural protein 1 of influenza viruses inhibits rapid mRNA degradation mediated by double-stranded RNA-binding protein, staufen1.
23524536 2013 Staufen1 dimerizes through a conserved motif and a degenerate dsRNA-binding domain to promote mRNA decay.
23395680 2013 New partner proteins containing novel internal recognition motif for human glutaminase interacting protein (hGIP).
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22978549 2012 ESCRT-II's involvement in HIV-1 genomic RNA trafficking and assembly.
22810585 2012 Viral immune modulators perturb the human molecular network by common and unique strategies.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22584570 2012 Neurodegeneration-associated TDP-43 interacts with fragile X mental retardation protein (FMRP)/Staufen (STAU1) and regulates SIRT1 expression in neuronal cells.
22503102 2012 Staufen1-mediated mRNA decay functions in adipogenesis.
22431750 2012 The RNA-binding protein Staufen1 is increased in DM1 skeletal muscle and promotes alternative pre-mRNA splicing.
21945618 2011 Impairment of the Staufen1-NS1 interaction reduces influenza viral replication.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21307942 2011 lncRNAs transactivate STAU1-mediated mRNA decay by duplexing with 3' UTRs via Alu elements.
21269460 2011 Initial characterization of the human central proteome.
20504931 2010 Human Staufen1 protein interacts with influenza virus ribonucleoproteins and is required for efficient virus multiplication.
20459747 2010 Live cell visualization of the interactions between HIV-1 Gag and the cellular RNA-binding protein Staufen1.
20075165 2010 Multimerization of Staufen1 in live cells.
20064372 2009 A physical and regulatory map of host-influenza interactions reveals pathways in H1N1 infection.
20053637 2010 Novel Staufen1 ribonucleoproteins prevent formation of stress granules but favour encapsidation of HIV-1 genomic RNA.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19029303 2009 Control of c-myc mRNA stability by IGF2BP1-associated cytoplasmic RNPs.
18806890 2008 Characterization of a novel transcript variant of human STAU1 gene.
18498651 2008 The host protein Staufen1 interacts with the Pr55Gag zinc fingers and regulates HIV-1 assembly via its N-terminus.
18094122 2008 A genome-wide approach identifies distinct but overlapping subsets of cellular mRNAs associated with Staufen1- and Staufen2-containing ribonucleoprotein complexes.
17510634 2007 Staufen1 regulates diverse classes of mammalian transcripts.
17428849 2007 The host protein Staufen1 participates in human immunodeficiency virus type 1 assembly in live cells by influencing pr55Gag multimerization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15680326 2005 Mammalian Staufen1 recruits Upf1 to specific mRNA 3'UTRs so as to elicit mRNA decay.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15303970 2004 Characterization of Staufen 1 ribonucleoprotein complexes.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15121898 2004 The composition of Staufen-containing RNA granules from human cells indicates their role in the regulated transport and translation of messenger RNAs.
15024055 2004 Identification of Staufen in the human immunodeficiency virus type 1 Gag ribonucleoprotein complex and a role in generating infectious viral particles.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12843282 2003 Barentsz, a new component of the Staufen-containing ribonucleoprotein particles in mammalian cells, interacts with Staufen in an RNA-dependent manner.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388589 2002 A receptor for activated C kinase is part of messenger ribonucleoprotein complexes associated with polyA-mRNAs in neurons.
12147688 2002 Identification of mRNA/protein (mRNP) complexes containing Puralpha, mStaufen, fragile X protein, and myosin Va and their association with rough endoplasmic reticulum equipped with a kinesin motor.
12133005 2002 Molecular mapping of the determinants involved in human Staufen-ribosome association.
12065664 2002 The RNA-binding protein Staufen from rat brain interacts with protein phosphatase-1.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
10823848 2000 The double-stranded RNA-binding protein Staufen is incorporated in human immunodeficiency virus type 1: evidence for a role in genomic RNA encapsidation.
10707969 2000 Molecular insights into mRNA transport and local translation in the mammalian nervous system.
10325410 1999 Interaction of influenza virus NS1 protein and the human homologue of Staufen in vivo and in vitro.
10022909 1999 Mammalian staufen is a double-stranded-RNA- and tubulin-binding protein which localizes to the rough endoplasmic reticulum.
10022908 1999 A human sequence homologue of Staufen is an RNA-binding protein that is associated with polysomes and localizes to the rough endoplasmic reticulum.
8884277 1996 Localization of a human double-stranded RNA-binding protein gene (STAU) to band 20q13.1 by fluorescence in situ hybridization.