Property Summary

Ligand Count 80
NCBI Gene PubMed Count 277
PubMed Score 803.65
PubTator Score 401.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.2e-03
Breast cancer -1.400 2.8e-04
COPD -1.100 5.9e-03
group 3 medulloblastoma -1.100 3.8e-03
intraductal papillary-mucinous neoplasm ... 1.200 4.9e-03
invasive ductal carcinoma -1.200 1.7e-03
juvenile dermatomyositis 1.054 3.4e-12
lung cancer -2.400 2.1e-04
lung carcinoma -1.600 3.0e-34
malignant mesothelioma -1.300 2.4e-05
medulloblastoma, large-cell -1.400 3.8e-04
osteosarcoma -1.894 8.2e-06
ovarian cancer -1.300 3.2e-06
psoriasis -1.600 3.2e-04
subependymal giant cell astrocytoma 1.668 1.7e-02

Gene RIF (250)

AA Sequence

MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQHLQASVGE      1 - 70
QGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHR     71 - 140
VGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQL    141 - 210
AGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPP    211 - 280
QVLKTQTKFQAGVRFLLGLRFLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENS    281 - 350
IPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN    351 - 420
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSME    421 - 490
AFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFL    491 - 560
LRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYK    561 - 630
PEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSI    631 - 700
PPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVED    701 - 770
SCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD    771 - 840
LRANPSW                                                                   841 - 847
//

Text Mined References (281)

PMID Year Title