Property Summary

NCBI Gene PubMed Count 201
PubMed Score 302.90
PubTator Score 308.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Juvenile rheumatoid arthritis 105 0.0 5.0
Disease Target Count Z-score Confidence
Vasculitis 64 3.185 1.6
ulcerative colitis 2087 3.014 1.5
Disease Target Count
Systemic lupus erythematosus 11 1

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma -2.500 2.4e-08
astrocytic glioma -2.000 3.1e-03
ependymoma -2.500 1.7e-03
oligodendroglioma -2.200 6.5e-03
cutaneous lupus erythematosus 1.400 2.3e-03
glioblastoma -1.600 5.0e-04
osteosarcoma -1.800 2.4e-03
group 3 medulloblastoma -2.100 9.3e-04
atypical teratoid / rhabdoid tumor -1.500 1.5e-04
medulloblastoma, large-cell -1.500 9.8e-03
primitive neuroectodermal tumor -1.500 1.4e-02
tuberculosis -1.300 4.1e-07
intraductal papillary-mucinous carcinoma... -1.500 3.9e-04
intraductal papillary-mucinous neoplasm ... -1.300 5.9e-03
lung cancer -2.600 1.8e-06
Breast cancer -1.700 4.7e-02
pediatric high grade glioma -1.400 7.7e-05
pilocytic astrocytoma -1.800 1.1e-05
primary Sjogren syndrome 1.100 1.4e-02
lung carcinoma -2.000 4.0e-20
Pick disease -1.700 1.0e-03
ulcerative colitis 1.200 9.0e-06

 GO Component (2)

Protein-protein Interaction (1)

Gene RIF (210)

PMID Text
26782418 Our findings indicate that although STAT4 and IFIH1 SNPs are not associated with T1D in a Brazilian population, they might play a role in susceptibility to T1D on a larger worldwide scale
26745093 SNP rs7574865 in STAT4 might contribute to progression to Hepatocellular Carcinoma.
26704347 STAT4 protein genetic variation is a prognostic factor predicting the treatment with interferon-alpha therapy in chronic hepatitis B.
26569609 the presence of the rs7574865 T allele enhances STAT4 mRNA transcription and protein expression
26538132 Five SNPs (rs7574865 in STAT4, rs9267673 near C2, rs2647073 and rs3997872 near HLA-DRB1 and rs9275319 near HLA-DQ), were found to be significantly associated with the risk of HBV-related LC.
26097239 CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 are bona fide susceptibility genes for Behcet's disease.
26066297 There is a significant association between STAT4 rs7574865 polymorphism and IBD susceptibility in overall population.
25963842 gene polymorphisms along with Ptpn22 polymorphism confers susceptibility to rheumatoid arthritis in all major ethnic groups. [meta-analysis]
25913043 our replication study showed that the rs7574865 in STAT4 and rs9275319 in HLA-DQ were not associated with CHB-related HCC in a Korean population.
25864744 Increased expression of STAT4 is positively correlated with the depth of invasion in colorectal cancer patients.
25852285 STAT4 may inhibit HCC development by modulating HCC cell proliferation.
25829184 STAT4 minor allele may be associated with the spontaneous clearance of HBV, whereas the major allele may be associated with the progress of the HBV-related liver disease.
25781893 STAT4 rs7574865 G/T and PTPN22 rs2488457 G/C polymorphisms as susceptibility factors for JIA
25771902 that STAT1, JAK2, and NFkappaB, together with STAT4, contribute to the development of cell-mediated immunity
25665738 This work reported the association of 14q32.11 (EFCAB11) with Hepatocellular carcinoma in Chinese Han population and revealed the genetic interaction between STAT4 (2q32.2-q32.3) and EFCAB11 (14q32.11) in Hepatocellular carcinoma.
25486484 Loss of STAT4 expression and associated switch to Th2 phenotype during Mycosis Fungoides progression may be driven via aberrant histone acetylation and/or upregulation of oncogenic miR-155 microRNA.
25369137 Evidence of a higher risk to develop pericarditis with STAT4 genotypes, and an association between HCP5 rs3099844 and anti-Ro/SSA antibodies in Italian systemic lupus erythematosus patients.
25365208 STAT4 rs7574865 seemed not to correlate with hepatitis B virus infection susceptibility or natural clearance; its role in hepatocellular carcinoma development seemed ambiguous
25179669 indicates that the 4 rs7574865 G/T polymorphism was significantly associated with a decreased rheumatoid arthritis like this risk in an Asian population
25178516 STAT4 rs7574865 polymorphism may be associated with significantly reduced risk of HBV-induced HCC in Asian
25041342 STAT4 rs7574865 seems to be Tibetan specific in hepatitis B virus natural clearance.
25019342 STAT4 rs7574865/rs10181656 polymorphisms increase the risk of autoimmune thyroid diseases in a Chinese population.
24979672 Rheumatoid arthritis cases showed a significantly higher frequency of the STAT4 T allele carriage (GT+TT genotypes) compared to controls.
24844303 STAT4 plays a crucial role in the function of innate and adaptive immune cells; dysregulated expression and aberrant activation of STAT4 is observed in many human autoimmune conditions.
24751105 Review/Meta-analysis: STAT4 rs7574865 polymorphism confers susceptibility to rheumatoid arthritis in major ethnic groups.
24697319 The gene interactions of the rs7574865 SNP with SNPS in IRF5, ETS1 and IKZF1 in Han Chinese SLE patients were defined. The T allele is a risk factor.
24648611 STAT4 is involved in primary biliary cirrhosis susceptibility and may play a role in anti-nuclear antibody status in the Japanese population.
24632671 The observations suggested that C8orf13-BLK, in combination with STAT4, plays a pivotal role in creating genetic susceptibility to polymyositis/dermatomyositis in Japanese individuals.
24614117 Significant association with alleles of two STAT4 markers and nominal association of Autoimmune Addison's disease with alleles at GATA3, is reported.
24610875 The G allele of rs897200 was associated with lower STAT4 expression.
24386384 genetic variations in STAT4 predispose to lupus nephritis and a worse outcome with severe renal insufficiency.
24321062 STAT4 and STAT6 involve in the regulation of Th1/Th2 cell
24312163 No evidence of association between common autoimmunity STAT4 and IL23R risk polymorphisms and non-anterior uveitis.
24162774 HIV-1 gp120 downregulates the expression of signal transducer and activator of transcription 4 (STAT4) in human B cells
24014567 A redundant interaction between IRF5 and STAT4 polymorphisms was found in susceptibility to the type I interferon pathway-associated rheumatic autoimmune diseases, systemic lupus erythematosus and rheumatoid arthritis.
23990947 STAT4 SNP rs7574865 is a disease-susceptible gene variant in type-1 autoimmune hepatitis in Japan
23912645 STAT4 rs7574865 is associated with Systemic lupus erythematosus susceptibility in the Iranian population and this single nucleotide polymorphism might be a factor in the pathogenesis of Systemic lupus erythematosus.
23773642 STAT4 rs7574865 is significantly associated with rheumatoid arthritis susceptibility in northern Chinese Han subpopulations.
23755762 STAT4 SNPs may play an important role in genetic susceptibility to systemic sclerosis in a Chinese population.
23748017 Studied HBV patients of chronic hepatitis B carriers, liver cirrhosis and hepatocellular carcinoma and found the STAT4 variant (rs7574865) was marginally associated with HCC susceptibility in CHB carriers in allelic and recessive genetic models.
23727609 STAT4 rs7574865 G/T polymorphism was associated with the risk of RA.
23628400 STAT4 polymorphisms are associated with autoimmune diseases which are characterized by a systemic pathology and anti-dsDNA antibody.
23360093 the STAT4 gene may play an important role in facilitating susceptibility to Type 1 diabetes in this Han Chinese population.
23295549 Studies indicate that genetic single nucleotide polymorphisms (SNPs) rs7574865 in STAT4 gene might be associated with rheumatoid arthritis (RA) susceptibility.
23242368 Genetic variants in STAT4 and HLA-DQ genes confer risk of hepatitis B virus-related hepatocellular carcinoma.
23202532 STAT-4-T-allele is identified as fibrogenic factor and seems to have a negative impact on HCV-induced fibrosis development
23064011 Investigation into the signaling mechanism suggested that phosphorylation of STAT-4 in response to IL-12 was sustained for a longer duration in aged CD4+ T cells as compared to CD4+ T cells from young subjects
23001997 STAT4 is a novel locus underlying Behcet's disease in Han Chinese.
22937072 patients with early arthritis who are homozygous for the T allele of rs7574865 in STAT4 may develop a more severe form of the disease with increased disease activity and disability.
22753649 The findings suggest that variants in the STAT4 gene may contribute differentially to susceptibility to rheumatoid arthritis in seropositive and in seronegative patients.
22730365 By participating in transcription complex with other co-factors, IRF5 and STAT4 harbour the potential of regulating a large number of target genes, which may contribute to their strong association with systemic lupus erythematosus
22729903 Our studies confirmed an association of the STAT4 C (rs7582694) variant with the development of SLE and occurrence of some clinical manifestations of the disease.
22718836 STAT4 regulates antiviral gamma interferon responses and recurrent disease during herpes simplex virus 2 infection.
22714917 This meta-analysis demonstrates that the STAT4 rs7574865 T allele confers susceptibility to autoimmune diseases.
22569826 These data demonstrated that the DNA methylation status of STAT4 is associated with genetic polymorphisms, providing insights into the interactions between genetic and epigenetic aberrances in STAT4 and inflammatory bowel diseases.
22483685 Our results indicate that the interaction of specific IL17A, interleukin 23 receptor, and STAT4 modulate susceptibility to intestinal Behcet's disease in the Korean population
22402141 This is the first study to show a positive association between a STAT4 polymorphism and polymyositis/dermatomyositis
22133489 Results indicate that single nucleotide polymorphisms in TBX21 and STAT4 might contribute to susceptibility to aplastic anemia (AA) in the Chinese population.
22077060 Data indicate that STAT4 might be the molecular target of miR-132, miR-212, and miR-200a.
22069275 according to the age of onset, the minor alleles of all four single-nucleotide polymorphisms of STAT4 and the same haplotypes showed significant association with the susceptibility of T1D in the early-onset subgroup
21740896 data provide a new information that the STAT4 (rs3024912 and rs3024908) polymorphisms may be the underlying cause of membranous glomerulonephritis, and these polymorphisms revealed by this study warrant further investigation
21683716 These findings strongly suggest that STAT4 genetic polymorphisms are associated with rheumatoid arthritis in Northwestern Chinese Han population
21543583 prolonged IL-12 stimulation of NK cells specifically decreases the level of activated STAT4 protein
21418779 results support involvement of the STAT4 gene in the genetic susceptibility to rheumatoid arthritis but not to autoimmune thyroid diseases in the Tunisian population
21258797 Demonstrate that STAT4 rs7582694 SNP was significantly associated with systemic lupus erythematosus in female Chinese population.
21237270 gene polymorphism is assiciated with acute renal allograft rejection in the Chinese population
21167895 Study found a strong association of SNP rs7574865 of STAT4 with the risk of systemic lupus erythematosus in a northern Han Chinese population
21163111 The TT genotype and T allele in STAT4 rs7574869 are susceptibility factors for systemic lupus erythematosus, especially for male SLE patients.
20962850 Observational study of gene-disease association. (HuGE Navigator)
20881011 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20861858 Observational study of gene-disease association. (HuGE Navigator)
20848568 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20822712 Our results do not show that the PTPN22, STAT4 and TRAF1/C5 gene polymorphisms may confer a direct risk of cardiovascular disease disease in patients with rheumatoid arthritis.
20822712 Observational study of gene-disease association. (HuGE Navigator)
20797713 Observational study of gene-disease association. (HuGE Navigator)
20716621 Observational study of gene-disease association. (HuGE Navigator)
20584675 HLA-DR4, PAD4 and STAT4 are overexpressed in rheumatoid arthritis and may be involved in the pathogenesis of RA.
20535138 STAT4 is a confirmed genetic risk factor for Sjogren's syndrome and could be involved in type 1 interferon pathway signaling.
20535138 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20498205 Meta-analysis of gene-disease association. (HuGE Navigator)
20479942 Observational study of gene-disease association. (HuGE Navigator)
20454450 STAT4 SNP rs7574865 is a disease-modifying gene variant in colonic CD.
20454450 Observational study of gene-disease association. (HuGE Navigator)
20453440 studies found that IRF5, STAT4 and BLK are associated not only with systemic lupus erythematosus, but also rheumatoid arthritis and systemic sclerosis [review]
20444755 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20439292 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20438790 The STAT4 TT genotype of rs7574865 may be a susceptible factor for Vogt-Koyanagi-Harada syndrome in a Chinese Han population, and the GG genotype of this SNP may confer susceptibility in male Behcet's disease patients.
20438790 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20383147 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20360187 These data reinforce the influence of STAT4 gene on primary Sjogren's Syndrome and as a general autoimmune gene.
20360187 Observational study of gene-disease association. (HuGE Navigator)
20353580 Observational study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20237121 the association of rs7574865 with susceptibility to RA has been replicated in all populations studied, including those of Asian and European descent but this finding was not reproduced in African Americans.
20237121 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20233754 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
20219786 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20176035 Our data demonstrated that the STAT4 genetic variants could predispose an individual to inflammatory bowl disease and its extra-intestinal ailments in Koreans
20176035 Observational study of gene-disease association. (HuGE Navigator)
20169389 results support STAT4 rs7574865 polymorphism as a susceptibility factor for systemic lupus erythematosus in populations of European and Asian origin. results also suggest that STAT4 rs7601754 polymorphism might be associated with SLE risk.
20169389 Meta-analysis of gene-disease association. (HuGE Navigator)
20153791 Our data suggest that the rs7574865 STAT4 single nucleotide polymorphism is a genetic susceptibility variant for ulcerative colitis but not Crohn's disease in the Spanish population.
20153791 Observational study of gene-disease association. (HuGE Navigator)
20131273 Observational study of gene-disease association. (HuGE Navigator)
20049410 Observational study of gene-disease association. (HuGE Navigator)
20045654 Polymorphisms of STAT1 and STAT4 are associated with increased susceptibility, pathological advancement, and development of proteinuria in childhood IgA nephropathy.
20045654 Observational study of gene-disease association. (HuGE Navigator)
19950257 Single nucleotide polymorphisms in TBX21 and STAT4 contribute uniquely and interactively to SSc susceptibility.
19950257 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19877059 BANK1 is a new systemic sclerosis genetic susceptibility factor. BANK1, IRF5, and STAT4 act with additive effects.
19877059 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19838193 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19762360 There was no association with ischemic heart disease or venous thromboembolism and the presence of two or more antiphospholipid antibodies was associated with the risk allele (OR(c)=1.6, 95% CI 1.2 to 2.0).
19762360 Observational study of gene-disease association. (HuGE Navigator)
19741008 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19737838 Observational study of gene-disease association. (HuGE Navigator)
19717398 The main association signal for STAT4 with systemic lupus erythematosus previously reported in Caucasians is the same in the Finnish population and this is the first study that confirms the association of STAT4 with SLE in a family cohort.
19717398 Observational study of gene-disease association. (HuGE Navigator)
19710469 STAT4 binding to target genes, while critical, is not the only determinant for STAT4-dependent gene programming during Th1 differentiation
19684152 A lack of significant associations of STAT4 with smoking in systemic lupus erythematosus was observed.
19684152 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19674979 Observational study of gene-disease association. (HuGE Navigator)
19644887 Our results establish STAT4 rs7574865 as a new systemic sclerosis genetic susceptibility factor.
19644887 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19644876 STAT4 and BLK displayed a strong genetic association with primary antiphospholipid syndrome.
19644876 Observational study of gene-disease association. (HuGE Navigator)
19605749 STAT4 appears to be a common susceptibility gene to Systemic Sclerosis in Caucasian and Asian populations.
19605749 Observational study of gene-disease association. (HuGE Navigator)
19605742 results show, for the first time, the positive correlation between the T allele of STAT4 rs7574865 and antiphospholipid syndrome.
19605742 Observational study of gene-disease association. (HuGE Navigator)
19588142 Meta-analysis confirms that the STAT4 rs7574865 polymorphism is associated with rheumatoid arthritis susceptibility in different ethnic groups.
19588142 Meta-analysis of gene-disease association. (HuGE Navigator)
19565500 There are associations between juvenile idiopathic arthritis and variants in the TNFAIP3, STAT4, and C12orf30 regions that have previously shown associations with other autoimmune diseases, including rheumatoid arthritis and systemic lupus erythematosus.
19565500 Observational study of gene-disease association. (HuGE Navigator)
19500629 single nucleotide polymorphism is associated with psoriasis in population of Crete, Greece
19500629 Observational study of gene-disease association. (HuGE Navigator)
19479340 The results of this meta-analysis demonstrated that STAT4 rs7574865 single nucleotide polymorphism is significantly associated with rheumatoid arthritis and systemic lupus erythematosus.
19479340 Meta-analysis of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19404967 Our results replicate and firmly establish the association of STAT4 and CTLA4 with RA and provide highly suggestive evidence for IL2/IL21 loci as a risk factor for RA.
19404967 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19371230 STAT4 is not associated with type 2 diabetes in the genetically homogeneous population of Crete.
19371230 Observational study of gene-disease association. (HuGE Navigator)
19362457 Focusing on how STAT4 work in concert with other transcription factors will hopefully provide a better mechanistic understanding of the pathogenesis of various autoimmune diseases.
19359411 STAT4 is required for optimal human Th1 lineage development
19333953 STAT4 is likely to be a crucial component in systemic lupus erythematosus pathogenesis in multiple racial groups
19333953 Observational study of gene-disease association. (HuGE Navigator)
19332627 Our results do not support a major role of the STAT4 rs7574865 gene polymorphism in susceptibility to or clinical manifestations of giant cell arteritis.
19332627 Observational study of gene-disease association. (HuGE Navigator)
19286670 STAT4 influences the genetic predisposition to systemic sclerosis phenotype.
19286670 Observational study of gene-disease association. (HuGE Navigator)
19282076 Genetic polymorphisms in the Jak-Stat signaling pathway are associated with an increased risk of new cardiovascular events in incident dialysis patients.
19282076 Observational study of gene-disease association. (HuGE Navigator)
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19225526 Our data confirmed association of STAT4 (rs7574865, odds ratio (OR) =1.71, P=3.55 x 10(-23)) and BLK (rs13277113, OR=0.77, P=1.34 x 10(-5)) with SLE
19225526 Observational study of gene-disease association. (HuGE Navigator)
19120275 The age at diagnosis is lowest in the patients carrying the homozygotes of a minor allele, middle in the heterozygotes, and highest in the homozygotes of a major allele, suggesting the dosage effects of risk alleles on the age of onset of disease.
19120275 Observational study of gene-disease association. (HuGE Navigator)
19110536 Observational study of gene-disease association. (HuGE Navigator)
19109131 The risk allele of STAT4 is associated with increased sensitivity to IFN-alpha signaling in systemic lupus erythematosus.
19092842 Additive effects of the major risk alleles of IRF5 and STAT4 in primary Sjogren's syndrome are reported.
19092842 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19019891 Data confirm STAT4 as a susceptibility gene for systemic lupus erythematosus and suggest the presence of at least two functional variants affecting levels of STAT4 and also indicate that the genes STAT4 and IRF5 act additively to increase the risk for SLE
19019891 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18803832 The same STAT4 risk allele is associated with SLE in Caucasian and Japanese populations.
18803832 Observational study of gene-disease association. (HuGE Navigator)
18802110 T helper (Th) type 1 cells expressing transgenic STAT4 beta (an isoform lacking the C-terminal transactivation domain) secrete significantly more tumor necrosis factor-alpha upon T cell receptor stimulation than transgenic STAT4alpha-expressing Th1 cells.
18759272 The association of STAT4 polymorphism rs7574865 with RA was validated in patients of Spanish origin and described for the first time in both clinical forms of inflammatory bowel disease, Crohn's disease, ulcerative colitis and type 1 diabetes mellitus.
18759272 Observational study of gene-disease association. (HuGE Navigator)
18703106 in a genetically homogeneous population, the STAT4 rs7574865 G/T polymorphism, which has been shown to be associated with several autoimmune diseases, is associated with susceptibility to type 1 diabetes (T1D)
18703106 Observational study of gene-disease association. (HuGE Navigator)
18625278 study concludes that mutant alleles or genotypes of both TRAF1 and STAT4 polymorphisms are associated with the development of Rheumatoid arthritis in our population.
18625278 Observational study of gene-disease association. (HuGE Navigator)
18579578 The SNP rs7582694 in STAT4 displayed a increased risk of systemic lupus erythematosus with two independent risk alleles of the IRF5.
18579578 Observational study of gene-disease association. (HuGE Navigator)
18576336 Our findings indicate an association between the STAT4 polymorphism rs7574865 and RA in 3 different populations, from Spain, Sweden, and The Netherlands, thereby confirming previous data.
18576336 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18576330 We conclude that STAT4 is associated with RA and SLE in the Japanese.
18576330 Observational study of gene-disease association. (HuGE Navigator)
18516230 STAT4 contributes to the phenotypic heterogeneity of systemic lupus erythematosus, predisposing specifically to more severe disease.
18516230 Observational study of gene-disease association. (HuGE Navigator)
18434327 STAT4 and the TRAF1/C5 loci are associated with rheumatoid arthritis susceptibility.
18434327 Observational study of gene-disease association. (HuGE Navigator)
18432273 STAT4 but not TRAF1/C5 variants influence the risk of developing rheumatoid arthritis and systemic lupus erythematosus in Colombians.
18432273 Observational study of gene-disease association. (HuGE Navigator)
18273036 Single nucleotide polymorphisms in the STAT4 gene are associated with primary Sjogren's syndrome.
18273036 Observational study of gene-disease association. (HuGE Navigator)
18204446 Genome-wide association study of gene-disease association. (HuGE Navigator)
17932559 A haplotype of the STAT4 gene shows consistent association with rheumatoid arthritis susceptibility across Whites and Asians.
17804842 Observational study of gene-disease association. (HuGE Navigator)
17804842 A haplotype of STAT4 is associated with increased risk for both rheumatoid arthritis and systemic lupus erythematosus, suggesting a shared pathway for these illnesses.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17532201 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17532201 STAT-4 T90089C polymorphism might be the genetic factor for the risk of asthma in the Chinese population
17095088 IFNAR2 cytoplasmic domain serves to link STAT4 to the IFNAR as a pre-assembled complex that facilitates cytokine-driven STAT4 activation.
17046972 these results indicate that STAT-4 can be finely tuned along with DC maturation through NF-kappaB activation and that its induction may be involved in preparing the DC to be receptive to the cytokine environment present in lymphoid organs.
16301617 identify and characterize the transcriptional regulatory elements in the promoter region of the human STAT4 gene.
16081070 The STAT4 is transactivated by Ikaros (Ik) and Ik binding elements were revealed in its promoter.
15744455 Observational study of gene-disease association. (HuGE Navigator)
15637551 Observational study of genotype prevalence and gene-disease association. (HuGE Navigator)
15087447 STAT4 signaling in human vascular endothelial cells is activated by interferon alpha but not by IL-12
12805384 requires the N-terminal domain for efficient phosphorylation
12716907 STAT4 is repressed by PIASx
12615922 STAT4 is constitutively activated in Crohn's patients but not in healthy volunteers
12496413 Active STAT4, essential for IL-12-mediated Th1 differentiation, is readily detectable in biopsies from Peyer's patches and ileal mucosa, and STAT4-DNA binding activity is demonstrable by electrophoretic mobility-shift assay of lamina propria lymphocytes.
12372421 STAT4 regulates IL-12-induced expression of the perforin gene in NK cells

AA Sequence

MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNLLIQLDEQLGR      1 - 70
VSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAANMPVQGPLEKSLQSSSVSERQ     71 - 140
RNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQTMDQSDKNSAMVNQEVLTLQEMLNSLDFKRK    141 - 210
EALSKMTQIIHETDLLMNTMLIEELQDWKRRQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLE    211 - 280
EQSTKMTYEGDPIPMQRTHMLERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKL    281 - 350
PELNYQVKVKASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH    351 - 420
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNLVFFNNPPPAT    421 - 490
LSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCKEHLPGKSFTFWTWLEAILDL    491 - 560
IKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFSESHLGGITFTWVDHSESGEVRFHSVEPYNK    561 - 630
GRLSALPFADILRDYKVIMAENIPENPLKYLYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIP    631 - 700
ISTIRSDSTEPHSPSDLLPMSPSVYAVLRENLSPTTIETAMKSPYSAE                          701 - 748
//

Text Mined References (202)

PMID Year Title
26782418 2015 Meta-analysis of STAT4 and IFIH1 polymorphisms in type 1 diabetes mellitus patients with autoimmune polyglandular syndrome type III.
26745093 2015 Single Nucleotide Polymorphisms in STAT3 and STAT4 and Risk of Hepatocellular Carcinoma in Thai Patients with Chronic Hepatitis B.
26704347 2016 Genetic variation in STAT4 predicts response to interferon-? therapy for hepatitis B e antigen-positive chronic hepatitis B.
26569609 2015 The Minor Allele of rs7574865 in the STAT4 Gene Is Associated with Increased mRNA and Protein Expression.
26538132 2015 Genetic variations in STAT4,C2,HLA-DRB1 and HLA-DQ associated with risk of hepatitis B virus-related liver cirrhosis.
26097239 2015 Brief report: association of CCR1, KLRC4, IL12A-AS1, STAT4, and ERAP1 With Behçet's disease in Iranians.
26066297 2015 Association of STAT4 rs7574865 polymorphism with susceptibility to inflammatory bowel disease: A systematic review and meta-analysis.
25963842 2015 Association of PTPN22 rs2476601 and STAT4 rs7574865 polymorphisms with rheumatoid arthritis: A meta-analysis update.
25913043 2015 Replication of genome wide association studies on hepatocellular carcinoma susceptibility loci of STAT4 and HLA-DQ in a Korean population.
25864744 Silencing of stat4 gene inhibits cell proliferation and invasion of colorectal cancer cells.
25852285 2015 Decreased STAT4 indicates poor prognosis and enhanced cell proliferation in hepatocellular carcinoma.
25829184 2015 STAT4 genetic polymorphisms association with spontaneous clearance of hepatitis B virus infection.
25781893 2015 STAT4 rs7574865 G/T and PTPN22 rs2488457 G/C polymorphisms influence the risk of developing juvenile idiopathic arthritis in Han Chinese patients.
25771902 2015 Immunohistochemical analysis of the expression of cellular transcription NF?B (p65), AP-1 (c-Fos and c-Jun), and JAK/STAT in leprosy.
25665738 2015 Replication the association of 2q32.2-q32.3 and 14q32.11 with hepatocellular carcinoma.
25486484 2014 Analysis of STAT4 expression in cutaneous T-cell lymphoma (CTCL) patients and patient-derived cell lines.
25369137 2014 A multilocus genetic study in a cohort of Italian SLE patients confirms the association with STAT4 gene and describes a new association with HCP5 gene.
25365208 2014 Association of HLA-DP/DQ and STAT4 polymorphisms with HBV infection outcomes and a mini meta-analysis.
25179669 2014 An updated meta-analysis of the signal transducer and activator of transcription 4 (STAT4) rs7574865 G/T polymorphism and rheumatoid arthritis risk in an Asian population.
25178516 2015 STAT4 gene polymorphism and risk of chronic hepatitis B-induced hepatocellular carcinoma.
25041342 2015 Association of HLA-DP/DQ, STAT4 and IL-28B variants with HBV viral clearance in Tibetans and Uygurs in China.
25019342 2014 Association between STAT4 gene polymorphisms and autoimmune thyroid diseases in a Chinese population.
24979672 2014 Signal transducer and activator of transcription 4 (STAT4) G>T gene polymorphism in Egyptian cases with rheumatoid arthritis.
24871463 2014 GWAS identifies novel SLE susceptibility genes and explains the association of the HLA region.
24844303 2014 Therapeutic potential of STAT4 in autoimmunity.
24751105 2015 Rs7574865 polymorphism in signal transducers and activators of transcription 4 gene and rheumatoid arthritis: an updated meta-analysis of 28 case-control comparisons.
24697319 2014 Gene-gene interactions of IRF5, STAT4, IKZF1 and ETS1 in systemic lupus erythematosus.
24648611 2014 STAT4 gene polymorphisms are associated with susceptibility and ANA status in primary biliary cirrhosis.
24632671 2014 Association between a C8orf13-BLK polymorphism and polymyositis/dermatomyositis in the Japanese population: an additive effect with STAT4 on disease susceptibility.
24614117 2014 Association of autoimmune Addison's disease with alleles of STAT4 and GATA3 in European cohorts.
24610875 2014 Association study of genes controlling IL-12-dependent IFN-? immunity: STAT4 alleles increase risk of pulmonary tuberculosis in Morocco.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
24386384 2013 Association of STAT4 polymorphism with severe renal insufficiency in lupus nephritis.
24321062 2013 [Relationship of reduced lung function with Th1/Th2 polarization, STAT4/6 expression in rats of chronic obstructive pulmonary disease].
24312163 2013 No evidence of association between common autoimmunity STAT4 and IL23R risk polymorphisms and non-anterior uveitis.
24097066 2013 A genome-wide association study in Han Chinese identifies a susceptibility locus for primary Sjögren's syndrome at 7q11.23.
24014567 2013 A redundant epistatic interaction between IRF5 and STAT4 of the type I interferon pathway in susceptibility to lupus and rheumatoid arthritis.
23990947 2013 Association of STAT4 polymorphisms with susceptibility to type-1 autoimmune hepatitis in the Japanese population.
23912645 2013 Association of STAT4 rs7574865 with susceptibility to systemic lupus erythematosus in Iranian population.
23773642 2013 Association of STAT4 gene polymorphism with increased susceptibility of rheumatoid arthritis in a northern Chinese Han subpopulation.
23755762 STAT4 is a genetic risk factor for systemic sclerosis in a Chinese population.
23748017 2013 A trivial role of STAT4 variant in chronic hepatitis B induced hepatocellular carcinoma.
23740937 2013 A systemic sclerosis and systemic lupus erythematosus pan-meta-GWAS reveals new shared susceptibility loci.
23727609 2013 Replication study of STAT4 rs7574865 G/T polymorphism and risk of rheumatoid arthritis in a Chinese population.
23628400 2013 Meta-analysis reveals an association of STAT4 polymorphisms with systemic autoimmune disorders and anti-dsDNA antibody.
23360093 2013 Association study of STAT4 polymorphisms and type 1 diabetes in Northeastern Chinese Han population.
23295549 2013 Association between polymorphism in STAT4 gene and risk of rheumatoid arthritis: a meta-analysis.
23291587 2013 Genome-wide association analysis identifies new susceptibility loci for Behçet's disease and epistasis between HLA-B*51 and ERAP1.
23273568 2013 Meta-analysis followed by replication identifies loci in or near CDKN1B, TET3, CD80, DRAM1, and ARID5B as associated with systemic lupus erythematosus in Asians.
23242368 2013 Genetic variants in STAT4 and HLA-DQ genes confer risk of hepatitis B virus-related hepatocellular carcinoma.
23202532 2013 Genetic variants of STAT-4 affect the development of graft fibrosis after liver transplantation for HCV-induced liver disease.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23064011 2012 Increased IL-21 secretion by aged CD4+T cells is associated with prolonged STAT-4 activation and CMV seropositivity.
23053960 2012 Genome-wide pathway analysis of genome-wide association studies on systemic lupus erythematosus and rheumatoid arthritis.
23001997 2012 Identification of a susceptibility locus in STAT4 for Behçet's disease in Han Chinese in a genome-wide association study.
23000144 2012 Genome-wide association study identifies TNFSF15 and POU2AF1 as susceptibility loci for primary biliary cirrhosis in the Japanese population.
22937072 2012 The TT genotype of the STAT4 rs7574865 polymorphism is associated with high disease activity and disability in patients with early arthritis.
22753649 2012 Variants within STAT genes reveal association with anticitrullinated protein antibody-negative rheumatoid arthritis in 2 European populations.
22740693 2012 The oncoprotein HBXIP uses two pathways to up-regulate S100A4 in promotion of growth and migration of breast cancer cells.
22730365 2013 Genome-wide profiling of target genes for the systemic lupus erythematosus-associated transcription factors IRF5 and STAT4.
22729903 2012 Contribution of STAT4 gene single-nucleotide polymorphism to systemic lupus erythematosus in the Polish population.
22718836 2012 STAT4 regulates antiviral gamma interferon responses and recurrent disease during herpes simplex virus 2 infection.
22714917 2012 Association of STAT4 rs7574865 polymorphism with autoimmune diseases: a meta-analysis.
22569826 2012 Abnormal genetic and epigenetic changes in signal transducer and activator of transcription 4 in the pathogenesis of inflammatory bowel diseases.
22483685 2012 Interactions between IL17A, IL23R, and STAT4 polymorphisms confer susceptibility to intestinal Behcet's disease in Korean population.
22402141 2012 Positive association between STAT4 polymorphisms and polymyositis/dermatomyositis in a Japanese population.
22133489 2012 The polymorphisms of T cell-specific TBX21 and STAT4 genes may contribute to the susceptibility of Chinese individuals to aplastic anemia.
22077060 2011 MicroRNA regulation of STAT4 protein expression: rapid and sensitive modulation of IL-12 signaling in human natural killer cells.
22069275 2011 Evidence for the role of STAT4 as a general autoimmunity locus in the Korean population.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21779181 2011 Identification of novel genetic markers associated with clinical phenotypes of systemic sclerosis through a genome-wide association strategy.
21750679 2011 Genome-wide scan identifies TNIP1, PSORS1C1, and RHOB as novel risk loci for systemic sclerosis.
21740896 2011 Association of STAT4 polymorphisms with susceptibility to primary membranous glomerulonephritis and renal failure.
21683716 2011 Signal transducer and activator of transcription 4 gene polymorphisms associated with rheumatoid arthritis in Northwestern Chinese Han population.
21543583 2011 Interleukin-12 treatment down-regulates STAT4 and induces apoptosis with increasing ROS production in human natural killer cells.
21418779 Signal transducer and activator of transcription and the risk of rheumatoid arthritis and thyroid autoimmune disorders.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
21399635 2011 Genome-wide association study identifies 12 new susceptibility loci for primary biliary cirrhosis.
21383967 2011 Meta-analysis of genome-wide association studies in celiac disease and rheumatoid arthritis identifies fourteen non-HLA shared loci.
21258797 2012 A single-nucleotide polymorphism of the STAT4 gene is associated with systemic lupus erythematosus (SLE) in female Chinese population.
21237270 2011 Polymorphisms in STAT4 increase the risk of acute renal allograft rejection in the Chinese population.
21167895 2011 Association of genetic variations in the STAT4 and IRF7/KIAA1542 regions with systemic lupus erythematosus in a Northern Han Chinese population.
21163111 2010 Variation in STAT4 is associated with systemic lupus erythematosus in Chinese Northern Han population.
20962850 2011 A targeted association study in systemic lupus erythematosus identifies multiple susceptibility alleles.
20881011 2011 Early disease onset is predicted by a higher genetic risk for lupus and is associated with a more severe phenotype in lupus patients.
20861858 2011 Association of EBF1, FAM167A(C8orf13)-BLK and TNFSF4 gene variants with primary Sjögren's syndrome.
20848568 2010 Genetically determined Amerindian ancestry correlates with increased frequency of risk alleles for systemic lupus erythematosus.
20822712 Lack of association of PTPN22, STAT4 and TRAF1/C5 gene polymorphisms with cardiovascular risk in rheumatoid arthritis.
20797713 2011 Endometriosis and autoimmune disease: association of susceptibility to moderate/severe endometriosis with CCL21 and HLA-DRB1.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20584675 2010 [Association of HLA-DR4, PAD4, and STAT4 expression in the peripheral blood with disease activity in patients with rheumatoid arthritis].
20535138 2010 STAT4 is a confirmed genetic risk factor for Sjögren's syndrome and could be involved in type 1 interferon pathway signaling.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20498205 2010 Investigation of potential non-HLA rheumatoid arthritis susceptibility loci in a European cohort increases the evidence for nine markers.
20479942 2010 Genetic risk factors in lupus nephritis and IgA nephropathy--no support of an overlap.
20454450 2010 Evidence for STAT4 as a common autoimmune gene: rs7574865 is associated with colonic Crohn's disease and early disease onset.
20453842 2010 Genome-wide association study meta-analysis identifies seven new rheumatoid arthritis risk loci.
20453841 2010 A regulatory variant in CCR6 is associated with rheumatoid arthritis susceptibility.
20453440 2010 Association of IRF5, STAT4 and BLK with systemic lupus erythematosus and other rheumatic diseases.
20444755 2010 Investigation of rheumatoid arthritis susceptibility genes identifies association of AFF3 and CD226 variants with response to anti-tumour necrosis factor treatment.
20439292 2010 Genetic variants in the prediction of rheumatoid arthritis.
20438790 2010 STAT4 polymorphism in a Chinese Han population with Vogt-Koyanagi-Harada syndrome and Behçet's disease.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20383147 2010 Genome-wide association study of systemic sclerosis identifies CD247 as a new susceptibility locus.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20360187 2010 Influence of STAT4 polymorphism in primary Sjögren's syndrome.
20353580 2010 Evaluation of the rheumatoid arthritis susceptibility loci HLA-DRB1, PTPN22, OLIG3/TNFAIP3, STAT4 and TRAF1/C5 in an inception cohort.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20237121 2010 Genetic variants of STAT4 associated with rheumatoid arthritis in persons of Asian and European ancestry do not replicate in African Americans.
20233754 2010 Cumulative association of 22 genetic variants with seropositive rheumatoid arthritis risk.
20219786 2011 The role of rheumatoid arthritis genetic susceptibility markers in the prediction of erosive disease in patients with early inflammatory polyarthritis: results from the Norfolk Arthritis Register.
20176035 2010 Association of signal transducer and activator of transcription 4 genetic variants with extra-intestinal manifestations in inflammatory bowel disease.
20169389 2010 A meta-analysis of the association of STAT4 polymorphism with systemic lupus erythematosus.
20153791 2010 STAT4 gene influences genetic predisposition to ulcerative colitis but not Crohn's disease in the Spanish population: a replication study.
20131273 2010 IRF5 is associated with primary antiphospholipid syndrome, but is not a major risk factor.
20049410 2010 A functionally relevant IRF5 haplotype is associated with reduced risk to Wegener's granulomatosis.
20045654 2010 Polymorphisms of signal transducers and activators of transcription 1 and 4 (STAT1 and STAT4) contribute to progression of childhood IgA nephropathy.
19950257 2009 Polymorphisms in TBX21 and STAT4 increase the risk of systemic sclerosis: evidence of possible gene-gene interaction and alterations in Th1/Th2 cytokines.
19877059 2009 BANK1 is a genetic risk factor for diffuse cutaneous systemic sclerosis and has additive effects with IRF5 and STAT4.
19838193 2009 Genome-wide association study in a Chinese Han population identifies nine new susceptibility loci for systemic lupus erythematosus.
19762360 2010 A STAT4 risk allele is associated with ischaemic cerebrovascular events and anti-phospholipid antibodies in systemic lupus erythematosus.
19741008 2009 Investigating the viability of genetic screening/testing for RA susceptibility using combinations of five confirmed risk loci.
19737838 2009 A haplotype in STAT4 gene associated with rheumatoid arthritis in Caucasians is not associated in the Han Chinese population, but with the presence of rheumatoid factor.
19717398 2010 Variation in STAT4 is associated with systemic lupus erythematosus in a Finnish family cohort.
19710469 2009 Temporal induction pattern of STAT4 target genes defines potential for Th1 lineage-specific programming.
19684152 2009 Cigarette smoking, STAT4 and TNFRSF1B polymorphisms, and systemic lupus erythematosus in a Japanese population.
19674979 2010 Overlap of disease susceptibility loci for rheumatoid arthritis and juvenile idiopathic arthritis.
19644887 2009 STAT4 is a genetic risk factor for systemic sclerosis having additive effects with IRF5 on disease susceptibility and related pulmonary fibrosis.
19644876 2009 Association of STAT4 and BLK, but not BANK1 or IRF5, with primary antiphospholipid syndrome.
19605749 2009 Association of STAT4 polymorphism with systemic sclerosis in a Japanese population.
19605742 2009 STAT4 single nucleotide polymorphism, rs7574865 G/T, as a risk for antiphospholipid syndrome.
19588142 2010 Association between the rs7574865 polymorphism of STAT4 and rheumatoid arthritis: a meta-analysis.
19565500 2009 Variants in TNFAIP3, STAT4, and C12orf30 loci associated with multiple autoimmune diseases are also associated with juvenile idiopathic arthritis.
19500629 2009 STAT4 gene polymorphism is associated with psoriasis in the genetically homogeneous population of Crete, Greece.
19479340 2010 Association of STAT4 polymorphism with rheumatoid arthritis and systemic lupus erythematosus: a meta-analysis.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19404967 2009 Confirmation of STAT4, IL2/IL21, and CTLA4 polymorphisms in rheumatoid arthritis.
19371230 2009 STAT4 is not associated with type 2 diabetes in the genetically homogeneous population of Crete.
19362457 2009 The Current STATus of lymphocyte signaling: new roles for old players.
19359411 2009 Impaired development of human Th1 cells in patients with deficient expression of STAT4.
19333953 2009 High-density genotyping of STAT4 reveals multiple haplotypic associations with systemic lupus erythematosus in different racial groups.
19332627 2009 Lack of association between STAT4 gene polymorphism and biopsy-proven giant cell arteritis.
19286670 2009 The STAT4 gene influences the genetic predisposition to systemic sclerosis phenotype.
19282076 2009 Association of single-nucleotide polymorphisms in JAK3, STAT4, and STAT6 with new cardiovascular events in incident dialysis patients.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19225526 2009 Population differences in SLE susceptibility genes: STAT4 and BLK, but not PXK, are associated with systemic lupus erythematosus in Hong Kong Chinese.
19165918 2008 Genetic variants near TNFAIP3 on 6q23 are associated with systemic lupus erythematosus.
19120275 2008 STAT4 polymorphism is associated with early-onset type 1 diabetes, but not with late-onset type 1 diabetes.
19110536 2009 Analysis of 17 autoimmune disease-associated variants in type 1 diabetes identifies 6q23/TNFAIP3 as a susceptibility locus.
19109131 2009 Cutting edge: autoimmune disease risk variant of STAT4 confers increased sensitivity to IFN-alpha in lupus patients in vivo.
19092842 2009 Additive effects of the major risk alleles of IRF5 and STAT4 in primary Sjögren's syndrome.
19019891 2009 STAT4 associates with systemic lupus erythematosus through two independent effects that correlate with gene expression and act additively with IRF5 to increase risk.
18803832 2008 Role of STAT4 polymorphisms in systemic lupus erythematosus in a Japanese population: a case-control association study of the STAT1-STAT4 region.
18802110 2008 STAT4 isoforms differentially regulate Th1 cytokine production and the severity of inflammatory bowel disease.
18759272 2008 Association of the STAT4 gene with increased susceptibility for some immune-mediated diseases.
18703106 2008 STAT4: a risk factor for type 1 diabetes?
18625278 2008 Association of a TRAF1 and a STAT4 gene polymorphism with increased risk for rheumatoid arthritis in a genetically homogeneous population.
18579578 2008 A risk haplotype of STAT4 for systemic lupus erythematosus is over-expressed, correlates with anti-dsDNA and shows additive effects with two risk alleles of IRF5.
18576336 2008 Association of STAT4 with rheumatoid arthritis: a replication study in three European populations.
18576330 2008 Association of STAT4 with susceptibility to rheumatoid arthritis and systemic lupus erythematosus in the Japanese population.
18516230 2008 Specificity of the STAT4 genetic association for severe disease manifestations of systemic lupus erythematosus.
18434327 2008 Re-evaluation of putative rheumatoid arthritis susceptibility genes in the post-genome wide association study era and hypothesis of a key pathway underlying susceptibility.
18432273 2008 STAT4 but not TRAF1/C5 variants influence the risk of developing rheumatoid arthritis and systemic lupus erythematosus in Colombians.
18273036 2008 Variant form of STAT4 is associated with primary Sjögren's syndrome.
18204446 2008 Genome-wide association scan in women with systemic lupus erythematosus identifies susceptibility variants in ITGAM, PXK, KIAA1542 and other loci.
18204098 2008 Association of systemic lupus erythematosus with C8orf13-BLK and ITGAM-ITGAX.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17932559 Association of STAT4 with rheumatoid arthritis in the Korean population.
17804842 2007 STAT4 and the risk of rheumatoid arthritis and systemic lupus erythematosus.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17532201 2007 Polymorphisms of STAT-6, STAT-4 and IFN-gamma genes and the risk of asthma in Chinese population.
17095088 2007 Pre-assembly of STAT4 with the human IFN-alpha/beta receptor-2 subunit is mediated by the STAT4 N-domain.
17046972 2007 NF-{kappa}B is required for STAT-4 expression during dendritic cell maturation.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16301617 2005 STAT4 expression in human T cells is regulated by DNA methylation but not by promoter polymorphism.
16081070 2005 STAT4 is a target of the hematopoietic zinc-finger transcription factor Ikaros in T cells.
15744455 2005 Association analysis of signal transducer and activator of transcription 4 (STAT4) polymorphisms with asthma.
15637551 2005 Association analysis of common variants of STAT6, GATA3, and STAT4 to asthma and high serum IgE phenotypes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15087447 2004 Interferon alpha but not interleukin 12 activates STAT4 signaling in human vascular endothelial cells.
14660657 2004 STAT4 is required for interleukin-12-induced chromatin remodeling of the CD25 locus.
12805384 2003 STAT4 requires the N-terminal domain for efficient phosphorylation.
12716907 2003 PIASx is a transcriptional co-repressor of signal transducer and activator of transcription 4.
12615922 2003 Constitutive STAT3 activation in intestinal T cells from patients with Crohn's disease.
12496413 2003 Activated STAT4 and a functional role for IL-12 in human Peyer's patches.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12426389 2002 A novel nuclear zinc finger protein EZI enhances nuclear retention and transactivation of STAT3.
12372421 2002 The human perforin gene is a direct target of STAT4 activated by IL-12 in NK cells.
12039028 2002 Signaling through the JAK/STAT pathway, recent advances and future challenges.
11801649 2002 Synergy of IL-12 and IL-18 for IFN-gamma gene expression: IL-12-induced STAT4 contributes to IFN-gamma promoter activation by up-regulating the binding activity of IL-18-induced activator protein 1.
11397944 2001 Role of T-bet in commitment of TH1 cells before IL-12-dependent selection.
10961885 2000 Importance of the MKK6/p38 pathway for interleukin-12-induced STAT4 serine phosphorylation and transcriptional activity.
10779770 2000 Stat4 is expressed in activated peripheral blood monocytes, dendritic cells, and macrophages at sites of Th1-mediated inflammation.
10415122 1999 Direct interaction of STAT4 with the IL-12 receptor.
9989503 1999 Functional association of Nmi with Stat5 and Stat1 in IL-2- and IFNgamma-mediated signaling.
9890938 1999 Identification of a STAT4 binding site in the interleukin-12 receptor required for signaling.
9630226 1998 Crystal structure of a tyrosine phosphorylated STAT-1 dimer bound to DNA.
9284918 1997 cDNA cloning, expression and chromosome mapping of the human STAT4 gene: both STAT4 and STAT1 genes are mapped to 2q32.2-->q32.3.
8700208 1996 Requirement for Stat4 in interleukin-12-mediated responses of natural killer and T cells.
8007943 1994 Stat4, a novel gamma interferon activation site-binding protein expressed in early myeloid differentiation.
7638186 1995 Interleukin 12 induces tyrosine phosphorylation and activation of STAT4 in human lymphocytes.