Property Summary

Ligand Count 89
NCBI Gene PubMed Count 2,143
PubMed Score 6459.66
PubTator Score 3667.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (10)

Disease Target Count Z-score Confidence
psoriasis 6694 4.051 1.04203497549889E-6
Adenocarcinoma 122 0.0 0.0
Arthritis, Experimental 39 0.0 0.0
Arthritis, Juvenile 126 0.0 0.0
Atherosclerosis 291 0.0 0.0
Atrophy 10 0.0 0.0
Autoimmune Diseases 67 0.0 0.0
Autoimmune disease, multisystem, infantile-onset, 1 1 0.0 0.0
Brain Ischemia 110 0.0 0.0
Breast Neoplasms 445 0.0 0.0
Carcinoma 11493 0.0 0.9
Carcinoma, Non-Small-Cell Lung 107 0.0 0.0
Carcinoma, Squamous Cell 110 0.0 0.0
Carcinoma, squamous cell of head and neck 31 0.0 0.0
Cardiomegaly 116 0.0 0.0
Cardiomyopathies 110 0.0 0.0
Cell Transformation, Neoplastic 97 0.0 0.0
Colitis, Ulcerative 59 0.0 0.0
Colonic Neoplasms 142 0.0 0.0
Copper-Overload Cirrhosis 11 0.0 0.0
Diabetes Mellitus, Type 1 43 0.0 0.0
Disease Models, Animal 155 0.0 0.0
Fever 138 0.0 0.0
Fibrosis 44 0.0 0.0
Hepatitis, Chronic 23 0.0 0.0
Hernias, Diaphragmatic, Congenital 17 0.0 0.0
Hyper-Ige Recurrent Infection Syndrome, Autosomal Dominant 1 0.0 0.0
Infarction, Middle Cerebral Artery 33 0.0 0.0
Inflammation 120 0.0 0.0
Job Syndrome 3 0.0 0.0
Leukemia, Myeloid, Acute 105 0.0 0.0
Leukemia, T-Cell 5 0.0 0.0
Leukemia-Lymphoma, Adult T-Cell 30 0.0 0.0
Liver Neoplasms, Experimental 59 0.0 0.0
Liver neoplasms 130 0.0 0.0
Lymphatic Metastasis 15 0.0 0.0
Lymphoma, Large-Cell, Anaplastic 4 0.0 0.0
Lymphoma, T-Cell 13 0.0 0.0
Mammary Neoplasms, Animal 136 0.0 0.0
Mammary Neoplasms, Experimental 154 0.0 0.0
Memory Disorders 40 0.0 0.0
Neoplasm Metastasis 168 0.0 0.0
Ovarian Neoplasms 102 0.0 0.0
Pancreatic Neoplasms 85 0.0 0.0
Precancerous Conditions 80 0.0 0.0
Precursor B-Cell Lymphoblastic Leukemia-Lymphoma 12 0.0 0.0
Prostatic Neoplasms 495 0.0 0.0
Reperfusion Injury 86 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Uterine Cervical Neoplasms 26 0.0 0.0
medulloblastoma 720 0.0 0.0
Disease Target Count
AUTOIMMUNE DISEASE, MULTISYSTEM, INFANTILE-ONSET 1
Acquired scoliosis 281
Adult T-Cell Lymphoma/Leukemia 30
Animal Mammary Neoplasms 136
Atelectasis 8
Atrophic 10
Broad flat nasal bridge 236
Bulging forehead 66
Byzanthine arch palate 194
Celiac disease 116
Chronic otitis media 52
Cleft Palate 271
Coarse facial features 108
Congenital diaphragmatic hernia 67
Coughing 25
Curvature of spine 282
Depressive disorder 409
Diabetes Mellitus, Insulin-Dependent 48
Dystrophic fingernails 18
Eczema 45
Elevated IgE 10
Enophthalmos 75
Eosinophilia 28
Exanthema 43
Failure of exfoliation of primary tooth 8
Frequent fractures 53
Frontal bossing 157
Generalized abnormality of skin 1
Generalized osteopenia 99
Gingivitis 29
Hair shaft abnormalities 30
Hyper-Immunoglobulin E Syndrome, Autosomal Dominant 1
Increased fracture rate 53
Infantile onset 238
Joint hyperflexibility 78
Juvenile arthritis 126
Ki-1+ Anaplastic Large Cell Lymphoma 4
Late tooth eruption 61
Leukemia, Myelocytic, Acute 120
Mammary Neoplasms 425
Nasal bridge wide 236
Neoplastic Cell Transformation 89
Orbital separation excessive 244
Osteopenia 99
Pancreatic Neoplasm 85
Papule 43
Paronychia Inflammation 9
Prominent forehead 66
Pruritus 58
Range of joint movement increased 32
Recurrent Staphylococcus aureus infections 4
Recurrent fungal infections 13
Recurrent respiratory infections 141
Recurrent sinopulmonary infections 6
Short stature 531
Skin Ulcer 48
Squamous cell carcinoma 129
Squamous cell carcinoma of the head and neck 29
Sunken eyes 63
T-Cell Lymphoma 13
Thickened facial skin with coarse facial features 108
Uranostaphyloschisis 167
Uterine Cervical Neoplasm 25
Varying degree of multiple fractures 53
Wide nose 35
ear infection chronic 52
hair abnormalities (non-specific) 30
non-small cell lung carcinoma 317
ovarian neoplasm 99
ulcerative colitis 1819
Disease Target Count Z-score Confidence
Immune system cancer 140 0.0 1.6
Lymphoid leukemia 160 0.0 1.6
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 3.314 1.7
Crohn's disease 321 0.0 0.00543898835061755
Disease Target Count Z-score Confidence
Job's syndrome 3 5.905 3.0
Herpes zoster 68 0.0 5.0
Prostate cancer 175 0.0 5.0
Disease Target Count Z-score Confidence
diabetes mellitus 1728 3.755 1.9
Disease Target Count
Hyperimmunoglobulin E syndrome 1

Expression

  Differential Expression (18)

Disease log2 FC p
Crohn's disease 1.021 5.4e-03
psoriasis 1.100 1.0e-06
adult high grade glioma 1.200 3.2e-04
astrocytoma 2.300 1.1e-03
Astrocytoma, Pilocytic 1.100 3.3e-06
Atopic dermatitis 1.200 1.6e-03
atypical teratoid / rhabdoid tumor 1.300 7.8e-07
ependymoma 1.100 4.3e-09
glioblastoma 2.200 6.1e-03
intraductal papillary-mucinous neoplasm ... -1.100 2.3e-03
lung adenocarcinoma 1.072 6.8e-04
lung cancer -1.900 6.4e-05
Multiple myeloma 1.402 1.0e-02
osteosarcoma 1.638 9.8e-05
ovarian cancer -1.800 1.3e-07
pancreatic ductal adenocarcinoma liver m... -1.832 3.2e-03
pituitary cancer -2.200 8.0e-07
Rheumatoid arthritis 1.200 1.9e-02

Protein-protein Interaction (2)

Gene RIF (2032)

AA Sequence

MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNLLGEIDQQYSR      1 - 70
FLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAATAAQQGGQANHPTAAVVTEK     71 - 140
QQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLKSQGDMQDLNGNNQSVTRQKMQQLEQMLTAL    141 - 210
DQMRRSIVSELAGLLSAMEYVQKTLTDEELADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQ    211 - 280
IKKLEELQQKVSYKGDPIVQHRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVR    281 - 350
LLVKFPELNYQLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN    351 - 420
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWYNMLTNNPKNV    421 - 490
NFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYSGCQITWAKFCKENMAGKGFS    491 - 560
FWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILSTKPPGTFLLRFSESSKEGGVTFTWVEKDISG    561 - 630
KTQIQSVEPYTKQQLNNMSFAEIIMGYKIMDATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPG    631 - 700
SAAPYLKTKFICVTPTTCSNTIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFESLTFDMELTSECATSPM    701 - 770
//

Text Mined References (2161)

PMID Year Title