Property Summary

NCBI Gene PubMed Count 121
PubMed Score 227.72
PubTator Score 197.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
psoriasis 1.300 5.4e-05
malignant mesothelioma -1.200 3.4e-05
cutaneous lupus erythematosus 1.400 1.8e-02
osteosarcoma 2.188 5.7e-10
medulloblastoma, large-cell -1.300 2.1e-03
juvenile dermatomyositis 2.307 1.2e-16
primary pancreatic ductal adenocarcinoma 1.515 2.3e-03
tuberculosis 1.200 7.1e-04
group 4 medulloblastoma 1.600 9.2e-04
Pick disease -1.100 1.3e-04
ovarian cancer 1.800 3.5e-05
pancreatic cancer 1.300 4.0e-03

Gene RIF (81)

PMID Text
26945968 These results suggest that STAT6 plays an important role in regulating Sp1 and BCL6 through STAT2 to exert the anti-proliferative effects of type I IFN.
26897526 These findings indicate that overexpression of IFITM1 enhances the aggressive phenotype of triple-negative SUM149 IBC cells and that this effect is dependent on STAT2/BRG1 interaction.
26397446 Interferonstimulated gene factor 3 complex, which consists of STAT1, STAT2 and IRF9, is required for the induction of SAMHD1 expression by IFN-alpha in SMMC-7721 cells.
26335850 transcriptional activation of Adar1 by IFN occurs in the absence of STAT1 by a non-canonical STAT2-dependent pathway in mouse but not human cells.
25965795 The results demonstrated that Peste-des-petits-ruminants virus V protein blocks interferon actions in a dose dependent manner and restrains the translocation of STAT1/2 proteins.
25921106 STAT2 rs2066807 polymorphism is not associated with cervical cancer.
25773664 IFN-beta exhibited significant cytotoxicity in HepG2 cells mainly through phosphorylation of STAT2.
25529283 TRAF2 and TRAF6 proteins are required for the HIV-1 Nef-induced tyrosine phosphorylation of STAT1 and STAT2 proteins. Both myristoylation and acidic cluster of Nef are essential to induce the tyrosine phosphorylation
25293394 Influenza virus-infected cells respond with increased induction of interferon beta upon Staphylococcus aureus super-infection, however, subsequent interferon-stimulated gene expression are rather impaired due to a block of STAT1-STAT2 dimerization.
25008924 TRAF2 and TRAF6 proteins are required for the HIV-1 Nef-induced tyrosine phosphorylation of STAT1 and STAT2 proteins. Both myristoylation and acidic cluster of Nef are essential to induce the tyrosine phosphorylation
24814927 These findings demonstrate that rotavirus probably employs a novel strategy to inhibit interferon-induced STAT signalling, which acts after STAT1/STAT2 activation and binding to importin-alpha.
24480984 Respiratory syncytial virus NS1 upregulates SOCS1 expression in a RIG-I- and TLR3-independent pathway, to inhibit STAT2 phosphorylation.
23878400 Data indicate that the RVB1/2 chromatin-remodeling complex is required for efficient Pol II recruitment and initiation at IFN-alpha-stimulated genes (ISGs) promoters and is recruited through interaction with the STAT2 transactivation domain.
23555265 Dengue virus co-opts UBR4 to degrade STAT2 and antagonize type I interferon signaling.
23391734 Sequencing of genomic DNA and RNA revealed a homozygous mutation in intron 4 of STAT2 that prevented correct splicing in patient cells
23139419 STAT2 serine 287 is a novel regulatory phosphorylation site in type I interferon-induced cellular responses
22883142 A haplotype at STAT2 introgressed from neanderthals serves as a candidate of positive selection in Papua New Guinea.
22859983 In systemic lupus erythematosus but not in healthy control leukocytes, Jak1 and STAT2 were constitutively phosphorylated, even in the absence of disease activity.
22634037 These results indicate the importance that herpes simplex virus 2 has assigned to STAT2, investing significant genomic currency throughout its replicative lifecycle for continuous targeted destruction and inhibition of this protein.
22523757 STAT2 is functionally involved in the immunosuppressive activity of hcMSCs as a novel regulator under inflammatory conditions.
22426484 Co-immunoprecipitation/immunoblot analyses showed that STAT2 enhanced RCAN1 ubiquitination through the ubiquitin E3 ligase FBW7..
22022391 PCBP2 stabilizes the mRNA of STAT1 and STAT2 through binding the 3'Untranslated Region (UTR) of these two molecules.
21886773 TRAF2 and TRAF6 proteins are required for the HIV-1 Nef-induced tyrosine phosphorylation of STAT1 and STAT2 proteins. Both myristoylation and acidic cluster of Nef are essential to induce the tyrosine phosphorylation
21795355 These findings highlight the role of Kaposi's sarcoma herpesvirus vFLIP in the activation of STAT1/STAT2 and STAT-responsive cellular genes in endothelial cells.
21498520 Chromatin dynamics of gene activation and repression in response to interferon alpha (IFN(alpha)) reveal new roles for phosphorylated and unphosphorylated forms of the transcription factor STAT2.
21399658 Data show that, in response to IFNalpha, STAT2 is recruited onto the endogenous P2p73 promoter together with the polycomb group protein Ezh2.
21354905 STAT1 and STAT2 are involved in the growth inhibition of HepG2 cells induced by phosphatidylethanolamine.
21268015 Signals ensued by IFN-alpha and IL-4 induce cytoplasmic sequestration of IL-4-activated STAT6 and IFN-alpha-activated STAT2:p48 in B cells through the formation of pY-STAT6:pY-STAT2:p48 complex.
21075352 Dengue virus 2 NS5 is able to bind and degrade human STAT2.
20937132 Wild-type V protein of Urabe AM9 strain of mumps virus may be more efficient than its mutant to inactivate both the interferon signaling pathway and antiviral response due to differences in their finest molecular interaction with STAT proteins.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20533260 STAT2 and IRF-1 comppete at binding interferon-stimulated response elements (ISREs) located on the retinoic acid-induced gene G (RIG-G) promoter in RIG-G.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20428775 These data indicate for the first time a mechanism involving STAT1/2 upregulation under the transcriptional control of INF-alpha signaling after knockdown of miR-221/222 cluster in U251 glioma cells.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20403236 STAT2 may interact with IRF-9 in a STAT1-independent manner. The complex STAT2/IRF-9 is the key factor mediating the expression of RIG-G gene regulated by IFN-alpha.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20068068 Defects in the expression or nuclear localization of STAT2 could lessen the efficacy of type I IFN immunotherapy.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19754307 This study showed that expression of dengue virus nonstructural protein 5 alone inhibits interferon-alpha signaling and thus signal transducer and activator of transcription 2 phosphorylation.
19730683 Observational study of gene-disease association. (HuGE Navigator)
19561067 Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha.
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19351818 Results provide evidence of the significance of IRF-9/STAT2 complex, and of an alternative pathway modulating the expression of IFN-stimulated genes.
19279106 the mature form of NS5, when not expressed as a precursor, was able to bind to STAT2 but was unable to target it for degradation, establishing a unique role for viral polyprotein processing in providing an additional function to a viral polypeptide
19159017 Data show that STAT2*C related genotypes and alleles are associated with asthma susceptibilities and pathogenesis.
19159017 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19007958 The interaction of measles virus V protein with STAT2 is carried by the cysteine-constrained peptide of 49 amino acids localized in the VCT region, and is essential to the inhibition of IFN-alpha/beta signaling.
18796709 Human cytomegalovirus infections downregulates STAT2 protein levels and interferes with tyrosine phosphorylation of STAT2.
18771758 ISRE, STAT1, and STAT2 have essential roles in the regulation of constitutive and IFN-alpha-mediated PD-1 expression in macrophages
18701593 The results provide genetic evidence that IE1 binding to STAT2 requires the 55-amino-acid acidic domain and promotes viral growth by interfering with interferon signaling
18579593 STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition.
18456457 The data suggest that liberation of the IFNaR2-ICD by regulated proteolysis could trigger a novel mechanism for moving the transcription factor Stat2 to the nucleus.
18370868 These data define the role of the ISGF3 members in IFN-beta inhibitory signaling.
18338947 Observational study of gene-disease association. (HuGE Navigator)
17538964 presence of intracellular HCV antigens led to transcriptional and protein expression of IL-8 (CXCL-8), and impaired interferon induction of signal transducers and activators of transcription 1 (STAT1) serine and tyrosine and STAT2 tyrosine phosphorylation
17442890 A mutation in STAT2 that confers an apoptotic effect in tumor cells in response to type I interferons, is described.
16978698 These results suggest that RSV can inhibit the phosphorylation of IFN-alpha-inducible STAT1 and STAT2 by inducing the expression of SOCS proteins in PMA-treated U937 cells.
16918696 Our data suggest that ATRA-induced regulation of Stat2, ICSBP and C/EBPepsilon is dependent on active Stat1, and that a failure to correctly regulate these transcription factors is associated with the inhibition of monocytic differentiation.
16689942 Data reveal the existence of a collection of GAS-regulated target genes whose expression is interferon-inducible and independent of ISGF3 but highly dependent on the STAT2 DNA binding domain.
16501077 Rabies virus P protein inhibits interferon signaling via activation-dependent binding to STAT1 and STAT2
15717316 IFNaR2 intracellular domain transcriptional modulation is dependent upon the carboxyl-terminal transactivation domain of Stat2.
15668228 the conserved DNA-binding domain of STAT2 has a role specific to the activity of ISGF3-independent STAT2-containing complexes
15650219 STAT2 activation and interferon signaling blocked by West Nile Virus nonstructural proteins
15221897 IFNalpha-induced nuclear accumulation of STAT2 was partially blocked in cell lines expressing high levels of HCV core protein. Subsequently
15175343 The regulation of STAT2 nuclear trafficking is distinct from the previously characterized STAT1 factor.
15165826 expression of STAT-2 induced by Epstein-Barr virus (EBV) LMP-1 (latent membrane protein) and may be part of the viral programming that regulates viral latency and cellular transformation
14722125 there is a critical motif in Stat2 required for its transcriptional activity, and resistance to type one IFNs can be mediated by mutations in Stat2
14557668 Hendra virus V protein inhibits cellular responses to IFN through binding and cytoplasmic sequestration of STAT2.
12804771 Measles virus V protein blocks INF-alpha/beta by inhibiting STAT2 phosphorylation.
12777975 Data suggest there is no defect in the JAK/STAT pathway in the tested melanoma cell lines, and that interferon resistance must be mediated through other components.
12610111 results suggest that the STAT2 activation process is a crucial target for the blockade of IFN-alpha signaling
12388709 Nipah virus V protein evades alpha and gamma interferons by preventing STAT2 activation and nuclear accumulation
12220192 Stat2 binds more avidly to subunit 2 of the interferon alpha receptor (IRNaR2) than to phosphorylated IFNaR1.
12050355 acts as a host range determinant for species-specific paramyxovirus interferon antagonism and simian virus 5 replication
12048190 arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5
11932384 results constitute genetic and biochemical evidence supporting a paramyxovirus-induced, IFN-independent STAT protein degradation complex that contains at least STAT1 and STAT2
11804954 IFNtau did not affect IRF-1 expression in Stat2-deficient cells
11786546 In this study we have characterized the Stat2-IFNaR2 interaction and examined its role in IFNalpha signaling

AA Sequence

MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLFFHFLDQLNYE      1 - 70
CGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVES     71 - 140
QQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRR    141 - 210
KEVLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELK    211 - 280
GLSCLVSYQDDPLTKGVDLRNAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRL    281 - 350
QEGNESLTVEVSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG    351 - 420
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQNQQFFSNPPK    421 - 490
APWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWADFTKRESPPGKLPFWTWLDKI    491 - 560
LELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLLRFSESSEGGITCSWVEHQDDDKVLIYSVQP    561 - 630
YTKEVLQSLPLTEIIRHYQLLTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSN    631 - 700
RQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMV    701 - 770
SQTVPEPDQGPVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF    771 - 840
YTDGPLMPSDF                                                               841 - 851
//

Text Mined References (127)

PMID Year Title
26945968 2016 The anti-proliferative effects of type I IFN involve STAT6-mediated regulation of SP1 and BCL6.
26897526 2016 Interferon-induced transmembrane protein 1 (IFITM1) overexpression enhances the aggressive phenotype of SUM149 inflammatory breast cancer cells in a signal transducer and activator of transcription 2 (STAT2)-dependent manner.
26397446 2015 Interferon-stimulated gene factor 3 complex is required for the induction of sterile ? motif and HD domain-containing protein 1 expression by interferon-? in SMMC-7721 cells.
26335850 2015 STAT2-dependent induction of RNA adenosine deaminase ADAR1 by type I interferon differs between mouse and human cells in the requirement for STAT1.
26122121 2015 Signal transducer and activator of transcription 2 deficiency is a novel disorder of mitochondrial fission.
25965795 2015 Identification of amino-acid residues in the V protein of peste des petits ruminants essential for interference and suppression of STAT-mediated interferon signaling.
25921106 2015 Association Study of Single-Nucleotide Polymorphisms of STAT2/STAT3/IFN-? Genes in Cervical Cancer in Southern Chinese Han Women.
25773664 2015 Inhibitory effects of interferon-? on hepatocellular carcinoma HepG2 via Akt/STAT phosphorylation.
25429064 2015 Meta-analysis of genome-wide association studies of adult height in East Asians identifies 17 novel loci.
25293394 2015 Super-infection with Staphylococcus aureus inhibits influenza virus-induced type I IFN signalling through impaired STAT1-STAT2 dimerization.
24814927 2014 Rotavirus inhibits IFN-induced STAT nuclear translocation by a mechanism that acts after STAT binding to importin-?.
24480984 2014 Respiratory syncytial virus NS1 protein degrades STAT2 by inducing SOCS1 expression.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24144296 2013 Nine loci for ocular axial length identified through genome-wide association studies, including shared loci with refractive error.
24065129 2013 IFN?-dependent increases in STAT1, STAT2, and IRF9 mediate resistance to viruses and DNA damage.
23878400 2013 The human RVB complex is required for efficient transcription of type I interferon-stimulated genes.
23555265 2013 Dengue virus co-opts UBR4 to degrade STAT2 and antagonize type I interferon signaling.
23456168 2013 Genome-wide association study in Han Chinese identifies three novel loci for human height.
23391734 2013 STAT2 deficiency and susceptibility to viral illness in humans.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23139419 2013 Identification of STAT2 serine 287 as a novel regulatory phosphorylation site in type I interferon-induced cellular responses.
22883142 2012 A haplotype at STAT2 Introgressed from neanderthals and serves as a candidate of positive selection in Papua New Guinea.
22859983 2012 Constitutive phosphorylation of interferon receptor A-associated signaling proteins in systemic lupus erythematosus.
22634037 2012 HSV-2 inhibits type-I interferon signaling via multiple complementary and compensatory STAT2-associated mechanisms.
22523757 2012 Gene expression profile reveals that STAT2 is involved in the immunosuppressive function of human bone marrow-derived mesenchymal stem cells.
22426484 2012 The transcription factor STAT2 enhances proteasomal degradation of RCAN1 through the ubiquitin E3 ligase FBW7.
22022391 2011 PCBP2 enhances the antiviral activity of IFN-? against HCV by stabilizing the mRNA of STAT1 and STAT2.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21795355 2011 Deletion of Kaposi's sarcoma-associated herpesvirus FLICE inhibitory protein, vFLIP, from the viral genome compromises the activation of STAT1-responsive cellular genes and spindle cell formation in endothelial cells.
21498520 2011 Chromatin dynamics of gene activation and repression in response to interferon alpha (IFN(alpha)) reveal new roles for phosphorylated and unphosphorylated forms of the transcription factor STAT2.
21399658 2011 p53-paralog DNp73 oncogene is repressed by IFN?/STAT2 through the recruitment of the Ezh2 polycomb group transcriptional repressor.
21354905 2011 [STAT1 and STAT2 participate in growth inhibition of human hepatoma HepG2 cells induced by phosphatidylethanolamine].
21269460 2011 Initial characterization of the human central proteome.
21268015 2011 Counter-regulation mechanism of IL-4 and IFN-? signal transduction through cytosolic retention of the pY-STAT6:pY-STAT2:p48 complex.
21075352 2010 Mouse STAT2 restricts early dengue virus replication.
20953190 2010 A genome-wide association study identifies new psoriasis susceptibility loci and an interaction between HLA-C and ERAP1.
20937132 2010 Interaction of mumps virus V protein variants with STAT1-STAT2 heterodimer: experimental and theoretical studies.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20533260 2010 [Role of the interferon-stimulated response elements I/II in expression regulation of the retinoic acid induced gene G].
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20428775 2010 Global changes of mRNA expression reveals an increased activity of the interferon-induced signal transducer and activator of transcription (STAT) pathway by repression of miR-221/222 in glioblastoma U251 cells.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20403236 2010 [A novel molecular mechanism of interferon alpha-regulated expression of retinoic acid-induced gene G].
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20068068 2010 Resistance to IFN-alpha-induced apoptosis is linked to a loss of STAT2.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19754307 2009 Dengue virus NS5 inhibits interferon-alpha signaling by blocking signal transducer and activator of transcription 2 phosphorylation.
19730683 2009 The variant rs1867277 in FOXE1 gene confers thyroid cancer susceptibility through the recruitment of USF1/USF2 transcription factors.
19561067 2009 Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha.
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19351818 2009 IRF-9/STAT2 [corrected] functional interaction drives retinoic acid-induced gene G expression independently of STAT1.
19279106 2009 NS5 of dengue virus mediates STAT2 binding and degradation.
19169254 2009 Genome-wide scan reveals association of psoriasis with IL-23 and NF-kappaB pathways.
19159017 2009 STAT2*C related genotypes and allele but not TLR4 and CD40 gene polymorphisms are associated with higher susceptibility for asthma.
19007958 2009 Inhibition of IFN-alpha/beta signaling by two discrete peptides within measles virus V protein that specifically bind STAT1 and STAT2.
18796709 2008 Human cytomegalovirus interferes with signal transducer and activator of transcription (STAT) 2 protein stability and tyrosine phosphorylation.
18771758 2008 Interferon-sensitive response element (ISRE) is mainly responsible for IFN-alpha-induced upregulation of programmed death-1 (PD-1) in macrophages.
18701593 2008 Binding STAT2 by the acidic domain of human cytomegalovirus IE1 promotes viral growth and is negatively regulated by SUMO.
18579593 2008 STAT2 is a primary target for measles virus V protein-mediated alpha/beta interferon signaling inhibition.
18456457 2008 Nuclear transit of the intracellular domain of the interferon receptor subunit IFNaR2 requires Stat2 and Irf9.
18370868 2008 IFN-beta-mediated inhibition of IL-8 expression requires the ISGF3 components Stat1, Stat2, and IRF-9.
18338947 2008 Multiple sclerosis and hepatitis C virus infection are associated with single nucleotide polymorphisms in interferon pathway genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17923090 2007 Acetylation-dependent signal transduction for type I interferon receptor.
17538964 2007 Engulfment of apoptotic cells expressing HCV proteins leads to differential chemokine expression and STAT signaling in human dendritic cells.
17442890 2007 A Mutation in the SH2 domain of STAT2 prolongs tyrosine phosphorylation of STAT1 and promotes type I IFN-induced apoptosis.
17351669 2007 STAT activation and differential complex formation dictate selectivity of interferon responses.
16978698 2007 Respiratory syncytial virus inhibits interferon-alpha-inducible signaling in macrophage-like U937 cells.
16918696 2006 Inhibition of monocytic differentiation by phosphorylation-deficient Stat1 is associated with impaired expression of Stat2, ICSBP/IRF8 and C/EBPepsilon.
16689942 2006 Identification of GAS-dependent interferon-sensitive target genes whose transcription is STAT2-dependent but ISGF3-independent.
16541075 2006 The finished DNA sequence of human chromosome 12.
16501077 2006 Inhibition of interferon signaling by rabies virus phosphoprotein P: activation-dependent binding of STAT1 and STAT2.
16227264 2005 Simian virus 5 V protein acts as an adaptor, linking DDB1 to STAT2, to facilitate the ubiquitination of STAT1.
15825084 2005 Hepatitis C virus expression suppresses interferon signaling by degrading STAT1.
15717316 2005 Intracellular domain of the IFNaR2 interferon receptor subunit mediates transcription via Stat2.
15668228 2005 Functional relevance of the conserved DNA-binding domain of STAT2.
15650219 2005 Inhibition of interferon signaling by the New York 99 strain and Kunjin subtype of West Nile virus involves blockage of STAT1 and STAT2 activation by nonstructural proteins.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15221897 2004 Expression of hepatitis C virus core protein inhibits interferon-induced nuclear import of STATs.
15175343 2004 STAT2 nuclear trafficking.
15165826 2004 Multiple signal transducers and activators of transcription are induced by EBV LMP-1.
14722125 2004 Identification of a novel conserved motif in the STAT family that is required for tyrosine phosphorylation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14645718 2003 Interferon-stimulated transcription and innate antiviral immunity require deacetylase activity and histone deacetylase 1.
14557668 2003 Hendra virus V protein inhibits interferon signaling by preventing STAT1 and STAT2 nuclear accumulation.
12804771 2003 Measles virus V protein blocks interferon (IFN)-alpha/beta but not IFN-gamma signaling by inhibiting STAT1 and STAT2 phosphorylation.
12777975 2003 The JAK/STAT pathway is not sufficient to sustain the antiproliferative response in an interferon-resistant human melanoma cell line.
12610111 2003 The STAT2 activation process is a crucial target of Sendai virus C protein for the blockade of alpha interferon signaling.
12509459 2003 Role of metazoan mediator proteins in interferon-responsive transcription.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12388709 2002 Nipah virus V protein evades alpha and gamma interferons by preventing STAT1 and STAT2 activation and nuclear accumulation.
12244326 2002 Chromatin-remodelling factor BRG1 selectively activates a subset of interferon-alpha-inducible genes.
12220192 2002 Affinity of Stat2 for the subunits of the interferon alpha receptor.
12167251 The roles of inflammation, STAT transcription factors, and nerve growth factor in viral reactivation and herpes keratitis.
12048190 2002 Arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5.
12039028 2002 Signaling through the JAK/STAT pathway, recent advances and future challenges.
11932384 2002 Selective STAT protein degradation induced by paramyxoviruses requires both STAT1 and STAT2 but is independent of alpha/beta interferon signal transduction.
11804954 2002 Roles of Stat1, Stat2, and interferon regulatory factor-9 (IRF-9) in interferon tau regulation of IRF-1.
11786546 2002 Stat2 binding to the interferon-alpha receptor 2 subunit is not required for interferon-alpha signaling.
11694501 2001 TYK2 and JAK2 are substrates of protein-tyrosine phosphatase 1B.
11564163 2001 Constitutive and interleukin-7- and interleukin-15-stimulated DNA binding of STAT and novel factors in cutaneous T cell lymphoma cells.
11150296 2001 Arginine/lysine-rich structural element is involved in interferon-induced nuclear import of STATs.
10702714 1999 Viral inhibition of interferon signal transduction.
10506573 1999 The chemokine SDF-1alpha triggers CXCR4 receptor dimerization and activates the JAK/STAT pathway.
10490982 1999 IFN-alpha activates Stat6 and leads to the formation of Stat2:Stat6 complexes in B cells.
10464260 1999 Stat protein transactivation domains recruit p300/CBP through widely divergent sequences.
10446176 1999 Urokinase induces activation and formation of Stat4 and Stat1-Stat2 complexes in human vascular smooth muscle cells.
9804758 1998 Role of the STAT1-SH2 domain and STAT2 in the activation and nuclear translocation of STAT1.
9677371 1998 Identification of amino acid residues critical for the Src-homology 2 domain-dependent docking of Stat2 to the interferon alpha receptor.
9242679 1997 Distinct STAT structure promotes interaction of STAT2 with the p48 subunit of the interferon-alpha-stimulated transcription factor ISGF3.
9121453 1997 Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.
9020188 1997 Stat2 is a transcriptional activator that requires sequence-specific contacts provided by stat1 and p48 for stable interaction with DNA.
8848048 1996 Cooperation of Stat2 and p300/CBP in signalling induced by interferon-alpha.
8621447 1996 Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.
8605877 1996 The SH2 domains of Stat1 and Stat2 mediate multiple interactions in the transduction of IFN-alpha signals.
8605876 1996 Phosphorylated interferon-alpha receptor 1 subunit (IFNaR1) acts as a docking site for the latent form of the 113 kDa STAT2 protein.
8601453 1996 Identification of alternative splicing form of Stat2.
7885841 1995 The genomic structure of the STAT genes: multiple exons in coincident sites in Stat1 and Stat2.
7746328 1995 Direct stimulation of Jak/STAT pathway by the angiotensin II AT1 receptor.
7559568 1995 Interaction of the transcriptional activator Stat-2 with the type I interferon receptor.
7532278 1995 Role of STAT2 in the alpha interferon signaling pathway.
1638633 1992 A transcription factor with SH2 and SH3 domains is directly activated by an interferon alpha-induced cytoplasmic protein tyrosine kinase(s).
1502204 1992 The proteins of ISGF-3, the interferon alpha-induced transcriptional activator, define a gene family involved in signal transduction.