Property Summary

NCBI Gene PubMed Count 628
PubMed Score 1889.26
PubTator Score 1350.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
breast carcinoma 1614 2.3e-27
juvenile dermatomyositis 1189 1.4e-20
lung carcinoma 2844 2.6e-12
Breast cancer 3098 1.3e-09
ulcerative colitis 2087 1.8e-08
non-small cell lung cancer 2798 4.2e-07
pilocytic astrocytoma 3086 2.2e-06
cutaneous lupus erythematosus 1056 4.4e-06
primary Sjogren syndrome 788 7.9e-06
psoriasis 6685 9.2e-06
pancreatic cancer 2300 5.5e-05
ependymoma 2514 6.3e-05
nasopharyngeal carcinoma 1056 1.1e-04
lung cancer 4473 1.3e-04
medulloblastoma, large-cell 6234 1.4e-04
active Crohn's disease 918 1.5e-04
ovarian cancer 8491 1.6e-04
lung adenocarcinoma 2714 1.9e-04
invasive ductal carcinoma 2950 2.0e-04
tuberculosis 1563 2.3e-04
atypical teratoid / rhabdoid tumor 4369 2.5e-04
group 4 medulloblastoma 1875 8.8e-04
systemic lupus erythematosus 172 9.4e-04
pediatric high grade glioma 2712 1.2e-03
intraductal papillary-mucinous carcinoma (IPMC) 2988 1.8e-03
dermatomyositis 966 2.5e-03
intraductal papillary-mucinous neoplasm (IPMN) 3289 3.2e-03
osteosarcoma 7933 4.0e-03
Atopic dermatitis 944 4.0e-03
glioblastoma 5572 4.3e-03
interstitial cystitis 2299 5.3e-03
intraductal papillary-mucinous adenoma (IPMA) 2956 7.2e-03
cystic fibrosis 1670 7.5e-03
pancreatic carcinoma 567 9.4e-03
Multiple myeloma 1327 1.1e-02
sarcoidosis 368 1.1e-02
Gaucher disease type 1 171 1.7e-02
pancreatic ductal adenocarcinoma liver metastasis 1795 1.8e-02
esophageal adenocarcinoma 737 2.1e-02
ductal carcinoma in situ 1745 2.5e-02
mucosa-associated lymphoid tissue lymphoma 480 2.6e-02
progressive supranuclear palsy 674 3.0e-02
Hydrolethalus syndrome 128 3.4e-02
Alzheimer's disease 644 3.7e-02
head and neck cancer and chronic obstructive pulmonary disease 237 4.0e-02
limb girdle muscular dystrophy 2I 56 4.6e-02
head and neck cancer 270 4.7e-02
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (48)

Disease log2 FC p
systemic lupus erythematosus 1.200 9.4e-04
pancreatic cancer 1.600 5.5e-05
Multiple myeloma 1.450 1.1e-02
ependymoma 1.500 6.3e-05
esophageal adenocarcinoma 1.900 2.1e-02
psoriasis -4.100 9.2e-06
cutaneous lupus erythematosus 3.400 4.4e-06
glioblastoma 1.700 4.3e-03
osteosarcoma 1.890 4.0e-03
atypical teratoid / rhabdoid tumor 1.600 2.5e-04
medulloblastoma, large-cell 1.200 1.4e-04
limb girdle muscular dystrophy 2I 1.119 4.6e-02
juvenile dermatomyositis 3.370 1.4e-20
Atopic dermatitis 1.800 4.0e-03
tuberculosis 1.800 2.3e-04
pancreatic ductal adenocarcinoma liver m... 1.356 1.8e-02
non-small cell lung cancer 1.070 4.2e-07
intraductal papillary-mucinous adenoma (... 1.600 7.2e-03
intraductal papillary-mucinous carcinoma... 1.600 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.600 3.2e-03
Hydrolethalus syndrome 1.132 3.4e-02
lung cancer -1.500 1.3e-04
active Crohn's disease 2.410 1.5e-04
ulcerative colitis 2.700 1.8e-08
sarcoidosis 2.000 1.1e-02
Multiple Sclerosis 1.400 1.1e-02
interstitial cystitis 3.200 5.3e-03
cystic fibrosis 1.400 7.5e-03
pediatric high grade glioma 1.500 1.2e-03
group 4 medulloblastoma 1.200 8.8e-04
pilocytic astrocytoma 1.700 2.2e-06
primary Sjogren syndrome 2.900 7.9e-06
pancreatic carcinoma -1.300 9.4e-03
invasive ductal carcinoma 2.400 2.0e-04
nasopharyngeal carcinoma 1.600 1.1e-04
lung adenocarcinoma 1.096 1.9e-04
Breast cancer 2.000 1.3e-09
lung carcinoma -1.200 2.6e-12
breast carcinoma 1.900 2.3e-27
Alzheimer's disease -1.300 3.7e-02
progressive supranuclear palsy -1.200 3.0e-02
mucosa-associated lymphoid tissue lympho... 1.129 2.6e-02
ductal carcinoma in situ 1.400 2.5e-02
ovarian cancer 2.300 1.6e-04
Gaucher disease type 1 -2.600 1.7e-02
dermatomyositis 3.200 2.5e-03
head and neck cancer 1.500 4.7e-02
head and neck cancer and chronic obstruc... 1.300 4.0e-02

Protein-protein Interaction (11)

MLP Assay (18)

AID Type Active / Inconclusive / Inactive Description
920 screening 695 / 0 / 195317 Primary cell-based high throughput screening assay to measure STAT1 inhibition
932 screening 5134 / 0 / 190878 Primary cell-based high throughput screening assay to measure STAT1 activation
1262 screening 1207 / 0 / 39 Confirmation cell-based high throughput screening assay to measure STAT1 activation
1263 screening 109 / 0 / 90 Confirmation cell-based high throughput screening assay to measure STAT1 inhibition
1303 screening 57 / 0 / 142 Counterscreen assay for STAT1 inhibitors: Cell-based high throughput assay to measure NF-kappaB inhibition
1306 screening 538 / 0 / 708 Counterscreen assay for STAT1 activators: Cell-based high throughput assay to measure NF-kappaB activation
1317 screening 328 / 0 / 887 Counterscreen assay for STAT3 inhibitors: Cell-based high throughput assay to measure STAT1 inhibition
1318 screening 156 / 0 / 1041 Counterscreen assay for STAT3 activators: Cell-based high throughput assay to measure STAT1 activation
1396 confirmatory 14 / 0 / 39 Dose response cell-based assay to measure STAT1 inhibition
1397 confirmatory 74 / 0 / 33 Dose response cell-based assay to measure STAT1 activation
More...

Gene RIF (543)

PMID Text
26966684 Stable isotope labeling by amino acids in cell culture (SILAC) was applied to analyze the STAT1 interactome after streptavidin pull-down of biotagged STAT1 from human embryonic kidney 293T cells with and without activation. Starting from more than 2,000 captured proteins 30 potential STAT1 interaction partners were extracted
26928402 Results showed that CD146 promoted metastasis of hepatocellular carcinoma (HCC) cells and predicted poor prognosis of HCC patients. CD146 induced epithelial mesenchymal transition through probably IL-8 up-regulation and STAT1 down-regulation.
26795953 findings suggest that PRMT1 is a central regulator of tissue remodeling and that the signaling sequence controlling its expression in primary human lung fibroblast is PDGF-ERK-STAT1.
26747737 STAT1 phosphorylation is impaired in juvenile idiopathic arthritis monocytes, consistent with skewing of systemic JIA monocytes away from an M1 phenotype.
26719274 Parainfluenza virus 3 therefore interferes with the phosphorylation of Stat1 downstream of the type III interferon receptor.
26678048 Our results suggest that NFkappaB, STAT1 and STAT3 underlie transcriptional changes and chronic inflammation in the aging human kidney
26676844 Our results showed that FAM172A could suppress proliferation of colon cancer cells, and STAT1 could bind to the minimum promoter region of FAM172A and upregulated the expression of FAM172A
26676749 a novel role for JAK2/STAT1 in EGFR-mediated immune evasion, and therapies targeting this signaling axis may be beneficial to block PD-L1 upregulation found in a large subset of head and neck cancer tumors.
26635038 STAT1 activation in association with JAK2 exon 12 mutations.
26604104 mutations are frequently observed in patients suffering from Chronic Mucocutaneous Candidiasis
26592235 5.5-kb upstream regulatory region may provide a regulatory platform for positive feedback control of STAT1 expression.
26560068 Data show the induction of signal transducer and activator of transcription (STAT)1 and IFN-stimulated gene 15 protein (ISG15) in Rickettsia conorii-infected human umbilical vein endothelial cells (HUVECs).
26514428 Genetic analyses showed that the three patients with recurrent oral thrush and ocular candidiasis since early childhood were heterozygous for a new mutation in STAT1
26504087 these results demonstrate that an interaction between STAT1, p300, and peroxisome proliferator-activated receptor-gamma is required for 15(S)-HETE-induced CD36 expression, oxidized low density lipoprotein uptake, and foam cell formation
26502610 When evaluating the effect of (-)-cytisine derivatives on activity of NF-kappaB and STATI, induced by specific agents (TNFalpha and IFNgamma, respectively) we observed that some compounds inhibited basal and stimulated activity of NF-kappaB and STAT1
26469385 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
26413796 Ultraviolet light-emitting-diode irradiation inhibits TNF-alpha and IFN-gamma-induced expression of ICAM-1 and STAT1 phosphorylation in human keratinocytes.
26401035 Infectious Bronchitis Coronavirus Inhibits STAT1 Signaling and Requires Accessory Proteins for Resistance to Type I Interferon Activity.
26397446 Interferonstimulated gene factor 3 complex, which consists of STAT1, STAT2 and IRF9, is required for the induction of SAMHD1 expression by IFN-alpha in SMMC-7721 cells.
26396258 Data show that JAK/STAT signaling inhibition is potentiated by Bcl-xL (B-cell lymphoma-extra large) blockade in interleukin 2 (IL-2) dependent adult T-cell leukemia cells.
26362649 Gene expression meta-analysis reveals immune response convergence on the IFNgamma-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma
26353965 NS of severe fever with thrombocytopenia syndrome virus inhibited the activity of IFN-alpha1, IFN-beta, IFN-lambda1 and IFN-lambda2 through inhibition of STAT1 phosphorylation.
26351076 expression of STAT1 or STAT1-CC enhances the effect of IFN-gamma and, IFN-beta on inhibition of human lung cancer cell proliferation, migration and invasiveness
26339056 this study determined the crystal structure of the N-terminal domain of STAT1 associated with the C-terminal half of the C protein.
26335850 transcriptional activation of Adar1 by IFN occurs in the absence of STAT1 by a non-canonical STAT2-dependent pathway in mouse but not human cells.
26275341 Similarly to a STAT1 mutant with impaired tetramerization, the N-terminal gain-of-function mutants showed elevated tyrosine-phosphorylation levels and prolonged nuclear accumulation upon stimulation of cells with IFNgamma.
26255980 Reduced STAT3-dependent gene transcription underlies low Th-17 responses in GOF-STAT1 CMC
26242181 CD163(+) TAMs in oral premalignant lesions coexpress CD163 and STAT1, suggesting that the TAMs in oral premalignant lesions possess an M1 phenotype in a Th1-dominated micromilieu.
26238487 Data indicate direct effects of sorafenib on the Janus kinase JAK1-transcription factors STAT3/5 signaling pathway in immune cells.
26193702 Data show that IFN-lambda induced a faster but shorter expression of suppressor of cytokine signaling 1 (SOCS1) which inhibited Janus kinase/signal transducer and activator of transcription (Jak/STAT) pathway and phosphorylation.
26156524 Our results provide insights on the losing equilibrium of the regulatory feedback loop between STAT1 and miR-155-5p influencing tumorigenesis.
26119280 Shp-2 contributes to the control of respiratory syncytial virus replication and progeny production in pulmonary alveolar epithelial cells by interfering with IFN-alpha-induced Jak/Stat1 pathway activation
26116514 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
26113305 Orf virus infection affected STAT1 phosphorylation in IFN-gamma or IFN-alpha treated HeLa cells.
26081906 Data highlight the tissue specificity function of EBP1 isoforms and show that only the oncogene p48 activates MHC II expression in human solid tumors, via STAT1 phosphorylation, in order to affect tumor progression by triggering specific immune response.
26080282 Th1 activity combined with impaired Treg resulted in the recurrent aortic aneurysms in this patient with a STAT1 GOF mutation.
26028607 Suggest JAK2/STAT1 signaling has key role in transducing endothelial transcriptomic changes induced by oxLDL.
26025667 we demonstrate that miR-150 and miR-223 specifically target STAT1, reducing it's expression and dampening STAT1-dependent signaling in human T cells.
25972070 STAT1-Induced HLA Class I Upregulation Enhances Immunogenicity and Clinical Response to Anti-EGFR mAb Cetuximab Therapy in HNC Patients.
25965795 The results demonstrated that Peste-des-petits-ruminants virus V protein blocks interferon actions in a dose dependent manner and restrains the translocation of STAT1/2 proteins.
25959715 -1 promotes IFN-alpha-induced autophagy via the JAK1-STAT1 signaling.
25943894 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
25905045 Reovirus T3D infection induced STAT-1, ISG-15, IFIT-1, Mx1 and IFIT-3 expression.
25880788 Data suggest that STAT Transcription Factors STAT1 and STAT3 defects have different effects on trained immunity.
25865496 We propose a model in which the risk allele of rs6590330 is associated with decreased ETS1 expression and increases SLE risk by enhancing the binding of pSTAT1.
25847223 These findings suggest that IL-6 blocking reduces the inflammatory mechanisms through the correction of STAT1 and STAT3 activation status.
25818476 JAK1, JAK2, and STAT1 are indispensable for the enhancement of prostaglandins production by follicular dendritic cell-like cells in response to IFN-gamma stimulation.
25773877 Increased expression of STAT1 was associated with metastases in Colon Carcinoma.
25771902 that STAT1, JAK2, and NFkappaB, together with STAT4, contribute to the development of cell-mediated immunity
25753288 Overexpression of STAT1 or of a constitutively active PI3Kalpha mutant failed to induce basal IDO production
25707685 The findings in our study suggest that STAT1 rs1467199 SNP plays a potential role in the IFN-gamma dependent development of autoimmunity in children with ITP.
25704763 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
25686822 High STAT1 expression is associated with pancreatic cancer.
25589644 HCV infection upregulates miR-373 expression and impairs the JAK/STAT signaling pathway.
25529283 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
25526807 DNA binding impairs the oscillation rate between STAT1 conformers.
25478796 Our study provides evidence to suggest that in ECs and VSMCs STAT1 orchestrates a platform for cross-talk between IFNgamma and TLR4, and identifies a STAT1-dependent gene signature
25474274 results show that AF extracts suppressed expression of inflammatory cytokines in association with inhibition of the IFN-beta signaling pathway and suppression of the formation of pSTAT1.
25438156 These findings support the concept that STAT1 exerts its tumor suppressor effects in esophageal squamous cell carcinoma via modulating the expression of key regulators of apoptosis and cell-cycle progression.
25378636 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
25355139 We have provided evidence that STAT1 attenuates the tumorigenicity of esophageal squamous cell carcinoma by inhibiting the STAT3 and NF-kappaB signaling pathway.
25311665 These findings clarify the mechanism underlying the therapeutic activity of suppressive oligodeoxynucleotides and support their use in Treg-based immunotherapy.
25293394 Influenza virus-infected cells respond with increased induction of interferon beta upon Staphylococcus aureus super-infection, however, subsequent interferon-stimulated gene expression are rather impaired due to a block of STAT1-STAT2 dimerization.
25288569 Two novel gain-of-function mutations of STAT1 responsible for chronic mucocutaneous candidiasis disease: impaired production of IL-17A and IL-22, and the presence of anti-IL-17F autoantibody.
25271158 Data show a mechanism by which glucocorticoid-induced S-adenosylmethionine enhances the antiviral activity of interferon alpha (IFN-alpha) by restoring signal transducer and activator of transcription 1 (STAT1) methylation in hepatitis B virus-infected cells.
25267067 found that STAT1 regulated MYC as well as ICAM1, PD-L1, and SMAD7, as well as the capacity for proliferation, adhesion, migration, invasion
25205818 Data suggest that STAT5A and STAT5B (highly conserved genes; 96% identity in amino acid sequences) are nearly identical in responses to growth hormone; STAT1 and STAT3 exhibit weaker binding to DNA elements in insulin-like growth factor-I gene.
25170834 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
25113744 signal transduction and activators of transcription (Stat) 1, p-Stat1 (Tyrosin 701), p-Stat1 (Serin 727), Stat3, pStat3 (Tyrosin 705) and glyceraldehyde 3-phosphatase dehydrogenase (GAPDH) was measured by Western blotting
25104439 STAT1 single nucleotide polymorphism is associated with breast cancer.
25056900 Varicella-zoster virus inhibits the nuclear translocation of phosphorylated-STAT1 and antiviral MX1 protein expression in human brain vascular adventitial fibroblasts.
25042743 Gain-of-function mutations in signal transducer and activator of transcription 1 (STAT1): chronic mucocutaneous candidiasis accompanied by enamel defects and delayed dental shedding.
25008924 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
24975396 STAT1 induces the expression of CSF-1.
24931237 NFAT-1, STAT-1 and AP-1 might be the central transcription factors in the pathogenesis of pre-eclampsia.
24894488 the present results revealed, for the first time, that Hes-1 could be SUMO-modified by PIAS1(STAT1) and GADD45alpha is a novel target of Hes-1
24878287 STAT-1 is overexpressed in human glioblastoma tissues and emerges as a novel prognostic biomarker
24858600 In monocytes of sepsis, STAT1 was found to regulate MD-2 expression.
24847715 conserved motif in the linker domain of STAT1 transcription factor is required for both recognition and release from high-affinity DNA-binding sites
24838635 study compared epithelioid malignant pleural mesothelioma in short and long survivors, and STAT1 as probably being responsible for antiapoptotic signaling and chemoresistance
24825907 RNAi silencing of Sp1 and STAT1 in breast cancer cells reduced PKC mRNA and protein expression, as well as PRKCE promoter activity.
24821973 a constitutive inhibitory interaction between the inactive vitamin D receptor (VDR) and Stat1, which was released upon stimulation with calcitriol and IFN-alpha.
24814927 These findings demonstrate that rotavirus probably employs a novel strategy to inhibit interferon-induced STAT signalling, which acts after STAT1/STAT2 activation and binding to importin-alpha.
24810717 unmodified STAT1 is cleaved at multiple sites by caspase-3 and caspase-6 in malignant undifferentiated hematopoietic cells
24769842 MM had decreased NK cell activity, lower expression of CD107a, and impaired IFN-gamma production and decreased expression of NKG2D, NKp46, and DNAM-1 receptors, which was followed by lower expression of perforin, STAT-1, and both IL-12R subunits in NK cells.
24742347 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
24736615 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
24725474 Our study confirms distinct prognostic relevance of STAT1 expression levels and STAT1 tyrosine phosphorylation in breast cancer patients and identifies an association of high STAT1 levels with elevated expression of STAT1 target genes
24715035 Gene expression regulation is changed in patients with type 2 diabetic bone disease.
24693969 Data indicate that signal transducer and activator of transcription 1 (STAT1) activation leads to HER2/ERBB2 downregulation in cancer cells.
24681956 B-cell lymphoma/leukemia 10 promotes oral cancer progression through STAT1/ATF4/S100P signaling pathway.
24658320 The loss of expression of Stat1 and p21 proteins corresponded to lymph node metastasis, advanced stage, tumor dedifferentiation, and poor prognosis in patients with pancreatic cancer.
24626739 PSTAT1 is a potential predictor of IFN response in patients with advanced renal cell carcinoma.
24562503 miR-146a facilitates a pro-inflammatory phenotype of Tregs via increased STAT1 activation, and contributes thereby to RA pathogenesis.
24478085 Infection with a type I, II, or III strain of Toxoplasma inhibits the dissociation of STAT1 from DNA, preventing its recycling and further rounds of STAT1-mediated transcriptional activation.
24454965 Members of Lactobacillus spp. influence human STAT1 and NF-kappaB p65 nuclear translocation in both intestinal epithelial cells as well as underlying macrophages.
24451065 Our data indicate a novel role for STAT1 in the pathogenesis of SLE as an expression enhancer of CCL2 and CXCL10 in systemic lupus erythematosus patients
24449862 The activated TNK1 potentiates JAK-STAT signaling through dual phosphorylation of STAT1 at tyrosine 701 and serine 727 amino acid positions.
24418364 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
24343863 developed a flow cytometry-STAT1 functional screening method that would greatly facilitate the diagnosis of chronic mucocutaneous candidiasis patients with GOF STAT1 mutations.
24292724 STAT1 and miR-146a may be upregulated during inflammation and via proinflammatory cytokines and chemokines in SLE. Prolonged upregulation of STAT1 and miR-146a appears to play an important role in anemia in SLE patients.
24239102 findings show that some heterozygous aberrations of STAT1 can be associated with progressive combined immunodeficiency, quite distinct from the limited susceptibilities to infection previously reported for heterozygous STAT1 mutations
24188975 Impaired IFN-gamma and TH17 responses in patients with Penicillium marneffei infections with gain-of-phosphorylation STAT1 mutations.
24086752 STAT1 regulates human glutaminase 1 promoter activity
23984931 Probucol could attenuate tert-butyl hydroperoxide induced mesangial cell senescence by regulating JAK2/STAT pathway.
23958647 IL-4 confers resistance to IL-27-mediated suppression on CD4+ T cells by imparing STAT1 signaling in asthmatic patients.
23950992 Data indicate that IL-6- and IFN-alpha-induced STAT3 phosphorylation and IFN-alpha-induced STAT1 phosphorylation were impaired in plasmacytoid dendritic cells (pDCs) from Crohn's disease (CD) patients.
23943785 Stat signaling and VEGF expression are inhibited by the antiangiogenic plant flavone acacetin
23941832 Data indicate that ruxolitinib effectively inhibited JAK/STAT signalling in hepatocellular carcinoma (HCC) cells with a significant reduction in the expression of JAK downstream targets pSTAT1 and pSTAT3.
23940278 Collectively, our in vitro and in vivo studies both support a critical role for MDA5 in the innate immune response against hepatitis B virus infection.
23922848 Two clinically relevant interface mutants of STAT1 exhibit gene-specific effects.
23920124 Data indicate that the anti-tumor effects of guggulsterone (GS) possibly involve multiple networks including inhibition of FAK, Src, and Jak/STAT signaling.
23917355 our results suggest that CUG2 enhances metastasis and drug resistance through STAT1 activation, which eventually contributes to tumor progression
23910645 Authors show that PP2Ac associates with Jak1/Tyk2/STAT1 and reduces Jak1/Tyk2/STAT1 phosphorylation resulting in an impairment of the IFNalpha-induced hepatitis C virus antiviral response.
23890093 Results demonstrate that HBV infection promotes miR146a transcription, which represses STAT1 and results in interferon resistance.
23856440 The measles virus phosphoprotein interacts with the linker domain of STAT1.
23796786 mutation results in impaired host defense against Candida and staphylococci in chronic mucocutaneous candidiasis patients
23756862 study revealed a significant correlation of high STAT1 activity with longer colorectal cancer patient overall survival
23741352 Zoledronic acid sensitizes renal cell carcinoma cells to radiation by downregulating STAT1.
23740952 Overexpression of either a single- or double-mutant STAT1 decreases IFN-gamma-mediated potentiation of CXCL10 gene expression, promoter activity, and secretion of protein.
23709754 Studied and assessed the biochemical impact of STAT1 mutations in nine patients with Chronic mucocutaneous candidiasis disease in Eastern Europe.
23708675 these data suggest that upregulated STAT1 and interferon signals by HPV16 E6 and E7 genes may play a major role in the relatively favorable prognosis for HPV-positive oropharyngeal squamous cell carcinoma cases with non-disruptive p53 mutations.
23704922 Elevated levels of IL-26 in human gastric cancer promote proliferation and survival by modulating STAT1/STAT3 signaling.
23703473 our findings suggest a novel strategy of using aspirin to overcome tumor resistance and enhance the effectiveness of IFN-alpha in HCC treatment through activating STAT1 gene, and have potential implications for improving future IFN-alpha protein and gene therapy.
23621408 IL-31 induces pro-inflammatory effects in activated human macrophages via STAT-1 and 5 phosphorylation. Interleukin-31-induced ERK 1/2 activation contributes to the underlying mechanism of Th1 cytokine IL-12 suppression in macrophages.
23609054 STAT-1 polymorphism is associated with the aggressive and severe forms of periodontal disease, indicating that this polymorphism may be an associated factor for severe periodontitis in the Brazilian population.
23588992 STAT1 may inhibit hepatocellular carcinoma cell growth by regulating p53-related cell cycling and apoptosis.
23585529 Mutation of the STAT1 tyrosine phosphorylation site was found in patients with multifocal osteomyelitis.
23585528 Elevated levels of STAT1 in Fanconi anemia group A lymphoblasts correlate with the cells' sensitivity to DNA interstrand crosslinking drugs.
23582260 Data indicate that beta-arrestin1 is dispensable for STAT1 dephosphorylation and the termination of IFNgamma signaling.
23554911 KGF could up-regulate IL-7 expression through the STAT1/IRF-1, IRF-2 signaling pathway, which is a new insight in potential effects of KGF on the intestinal mucosal immune system.
23541320 Gain-of-function mutations in STAT1 predispose to invasive, severe, disseminated dimorphic yeast infections, likely through aberrant regulation of IFN-gamma-mediated inflammation.
23535064 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
23534974 Gain-of-function mutations in STAT1 can cause an immune dysregulation-polyendocrinopathy-enteropathy-X-linked (IPEX)-like phenotype with normal frequency and function of Treg cells.
23487038 BAL1 represses the anti-proliferative and pro-apoptotic IFNgamma-STAT1-IRF1-p53 axis and mediates proliferation, survival and chemo-resistance in DLBCL.
23486482 STAT1 activity in breast cancer cells is responsible for shaping an immunosuppressive tumor microenvironment
23472246 Levels of STAT1 andor the protein expression of its negative regulators, PIAS1 and SOCS3, may be a good predictor of hepatitis C virus response to therapy.
23471820 A novel oncogenic pathway is identified that involves aberrant activation of the TYK2 and its downstream substrate, STAT1, which ultimately promotes T-cell acute lymphoblastic leukemia cell survival through the upregulation of BCL2 expression
23452095 IL-27 function as an anti-lymphangiogenic regulator in vitro by up-regulating chemokines and interfering with the mitogenic effect of growth factors through STAT1 activation.
23403048 Gain-of-function STAT1 mutations are associated with PD-L1 overexpression and a defect in B-cell survival.
23401241 Loss of TIMP3 is a hallmark of diabetic nephropathy, causing a concomitant STAT1-dependent and compartment-specific loss of FoxO1 activity.
23378427 Consistent with the results for STAT1 and IRF1, transcriptome analysis reveals downregulation of postinitiation mRNA biogenesis processes and pathways by tuberculosis infection, with and without interferon (IFN)-gamma stimulation.
23363816 Overexpression of SHP2 in nonmalignant keratinocytes inhibited IFN-gamma-mediated STAT1 phosphorylation.
23349666 phosphorylation of STAT-1 serine 727 residue is prolonged in HLA-B27-expressing monocyte-macrophage U937 cells after bacterial infection
23306614 we propose that VSV treatment combined with the selective regulation of genes such as STAT1 and OASL2 will improve therapeutic outcomes for CUG2-overexpressing tumors
23274199 Data indicate that tocilizumab enhanced the interferon-induced phosphorylation of STAT1 and inhibited SOCS3 expression and the phosphorylation of both STAT3 and ERK.
23271704 IFN-gamma induces BAFF expression in human intestinal epithelial cells through JAK/STAT signaling pathways that might activate the GAS and IRF-1-binding element in the BAFF promoter.
23240025 Our data suggest that the type I, II, and III strains of Toxoplasma use a similar mechanism to inhibit STAT1 transcriptional activity in the nucleus
23180800 The study demonstrates the substantial variation in DNA sequence preference caused by STAT1 phosphorylation, and multimerization capability.
23154639 The colon epithelial cell line Caco-2 was stimulated with interferon gamma, interleukin -4 prostaglandin E(2) to allow correlations between SOCS3 expression with STAT1, STAT6 and cyclic amp signaling.
23153456 Pre-conditioning of epithelial cells with IFNalpha initiated dramatic changes in IL-22 signaling normally dominated by signal transducer and activator of transcription (STAT)-3
23108375 Using two renal cellular models&SOCS-3 siRNA knockdown,we studied SOCS-3 effects on oncostatin M-induced STAT activation, differentiation and proliferation.SOCS-3 knockdown resulted in enhanced pSTAT1/3 phosphorylation & epithelial diff'n.
23086340 This work reveals an anti-angiogenic role of STAT1 activation that acts in Tie2-R849W-expressing endothelial cells to impair VEGF-A-mediated STAT3 signaling, bFGF production, and smooth muscle cell recruitment.
23076242 A more recent discovery is that Reston virus VP24 also binds STAT1 directly, suggesting that VP24 may operate in at least two separate branches of the interferon pathway.
23072252 Authors conclude that the suppression of epithelial cell STAT1 signal transduction by adherent-invasive Escherichia coli strains represents a novel mechanism by which the pathogen evades host immune responses to the infection.
23068100 These results provide evidence that activated STAT-1 and STAT-3 regulate VEGF expression indirectly, by modulating HIF-1alpha activity.
23043228 The sumoylation deficient STAT1 E705Q mutant displayed enhanced histone H4 acetylation on interferon-gamma-responsive promoter compared to wild-type STAT1.
22973045 Double-stranded RNA induces biphasic STAT1 phosphorylation by both type I interferon (IFN)-dependent and type I IFN-independent pathways.
22942432 A novel process is revealed in T cells in which phosphorylated SHP-2 sequestrates STAT1 transcription factor in order to prevent signaling through the molecule.
22920460 The release of STAT1 dimers from DNA enhances transcriptional activity on both interferon-driven reporter and endogenous target genes.
22844427 vSOCS inhibits IFN-alpha-induced Stat1/Stat3 signaling.
22838736 Stat1 alters IL-6 induced Stat3 activity and the expression of pro-apoptotic genes.
22828446 Low STAT1 phosphorylation is associated with acute graft-versus-host disease.
22811740 we demonstrate that opsonized live M. avium is phagocytosed by macrophages involving membrane receptors not related with JAK/STAT1 signalling pathway.
22808166 STAT1 bound on multienhancer 2 cooperates with RXRalpha located on apoCII promoter and upregulates apoCII expression only in macrophages.
22805310 our findings show how the phosphorylation status of STAT1 determines its function as a tumor suppressor
22757586 In addition, our results propose that unphosphorylated or serine-phosphorylated STAT1 can act as transcription factors of MUC4.
22748593 individuals carrying STAT1 mutations might also be susceptible to viral diseases. The mechanism underlying reactivation disease in patients with STAT1 mutations and chronic mucocutaneous candidosis could involve the impairment of memory T cells
22748021 Progesterone (5 mum) leads to phosphorylation of JAK1, JAK2 and STAT1 in a time-dependent manner in sperm.
22730530 This is the first report of a mutation affecting the DNA-binding domain of STAT1 as the genetic cause of sporadic chronic mucocutaneous candidiasis in two unrelated Japanese patients.
22693070 STAT1 expression is upregulated by nuclear EGFR and HER2, and that STAT3 synergizes with the three receptors to further enhance STAT1 expression.
22674974 Overexpression of hepatitis C virus NS5A proteins significantly inhibited IFN-induced IFN-stimulated response element (ISRE) signaling, phosphorylated STAT1 (P-STAT1) levels, and IFN-stimulated gene (ISG) expression compared to controls.
22647704 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
22573496 SH2 domain of STAT1 is important for tyrosine phosphorylation and DNA binding, as well as for antimycobacterial immunity.
22558273 HIV p17 highjacks a Rack-1/Jak-1/STAT-1 pathway in macrophages.
22558273 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
22539792 Transcription factor STAT1 is crucial for IFNgamma-dependent interleukin (IL)-31RA receptor expression.
22535619 High phospho-STAT1 expression is associated with mucosal relapse in ulcerative colitis.
22526675 The authors conclude that suppression of IFN-gamma-mediated Stat-1 tyrosine phosphorylation by Shiga toxins represent a novel mechanism by which Escherichia coli O157:H7 evades the host immune system.
22514085 The tumor with T1799A BRAF mutation and tumor sizes of 2 cm or more were clinicopathologic parameters associated with lower STAT1 activity.
22488367 results in vitro and in vivo suggested that IFNalpha are potential candidates for prevention of vessel invasion acting through inhibition of VEGF expression and need to be properly used when STAT1 expression is suppressed
22479354 Data indicate that both HIV-1 infection and IFN-alpha treatment increase glutaminase 1 (GLS1) expression through STAT1 phosphorylation and by binding to the GLS1 promoter.
22437822 study describes an autosomal dominant mutation in the SH2 domain of STAT1 that disrupts protein phosphorylation
22425562 IFNgamma-induced acetylated STAT1 homodimers are though inactive, suggesting that heterodimerization and complex formation can rescue STAT1 lacking a functional DBD.
22407921 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
22401175 Immunohistochemically, the lining synovium of Rheumatoid Aarthritis clearly expressed STAT1
22383882 Ebola virus interferon antagonist VP24 directly binds STAT1.
22381273 Both STATs 1 and 3 were highly expressed in cerebral arteriovenous malformation, mainly in the endothelium of AVM blood vessels and perivascular infiltrating inflammatory cells within the nidus.
22326919 The results favor a pro-survival role of NF-kappaB and a pro-apoptotic role of STAT-1 in human islet cells.
22320867 expression of pSTAT-1 and its correlation with estrogen receptor, progesterone receptor, caspase-3, and pAkt and prognosis in premenopausal and postmenopausal patients with invasive breast cancer
22262126 overexpression of STAT1 in human renal cell carcinoma is associated with the chemoradioresistance
22253910 E. coli O157:H7 subverts Stat-1 tyrosine phosphorylation in response to interferon-gamma through a still as yet unidentified secreted bacterial protein.
22242177 The strong predictive value of the IFN/STAT1 gene signature in the Proneural subtype may be due to chemotherapy and/or radiation resistance induced through prolonged constitutive signaling of these genes during the course of the illness.
22217266 results indicate that STAT1 is implicated in the mediation of Ang II-induced HMC senescence through p53/ p21Cip1 pathway.
22195034 Mutated STAT1 inhibits IL12R/IL-23R signaling, with hyperphosphorylation of STAT1 as the likely underlying molecular mechanism.
22194871 High IL-7 concentration can prime resting B cells to CD95-mediated apoptosis via an indirect mechanism.
22193460 STAT1 might mediate angiotensin II and hydrogen peroxide-induced glomerular mesangial cells senescence through p53/p21(Cip1) pathway and the relative abundance of STAT1 and STAT3.
22178447 Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer.
22174846 IL28B and STAT1-nuclear translocation in hepatocytes are independent predictors of response to treatment with peginterferon and ribavirin in chronic hepatitis C patients.
22115721 A different approach to determine the potency of a recombinant IFN-alpha preparation based on the activation of the signal transducers and activators of transcription 1 (STAT1) using flow cytometry technique.
22065572 Inhibitor of kappaB kinase epsilon (IKK(epsilon)), STAT1, and IFIT2 proteins define novel innate immune effector pathway against West Nile virus infection.
22038351 The STAT1 pathway might be involved in the regulation of IL-10 expression in HepG2.2.15 cells.
22025054 Studies indicate that the M1 macrophage phenotype is controlled by STAT1 and IRF5, whereas STAT6, IRF4 and PPARgamma regulate M2 macrophage polarization.
22022391 PCBP2 stabilizes the mRNA of STAT1 and STAT2 through binding the 3'Untranslated Region (UTR) of these two molecules.
22002246 a novel STAT1-DOT1L interaction that is required for the regulation JAK-STAT-inducible gene expression
21937453 Cytokines tumor necrosis factor-alpha and interferon-gamma induce pancreatic beta-cell apoptosis through STAT1-mediated Bim protein activation.
21886773 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
21796151 The data suggested that IL-17A can upregulate keratin-17 expression in keratinocytes in a dose-dependent manner through STAT1- and STAT3-dependent mechanisms.
21795355 These findings highlight the role of Kaposi's sarcoma herpesvirus vFLIP in the activation of STAT1/STAT2 and STAT-responsive cellular genes in endothelial cells.
21772053 The results suggested that exon 3 skipping of STAT1 leads to abnormal signaling in response to IFN-gamma and IFN-alpha, which is associated with susceptibility to intracellular pathogens and viruses.
21752694 STAT1 has been identified as a point of convergence for the cross-talk between the pro-atherogenic IFN-gamma, TLR4 and IL-6 activated pathways in immune as well as vascular cells, as such amplifying pro-inflammatory signals.
21734056 Both E6 and E7 oncoproteins independently suppress the expression of STAT-1, and mutational analyses indicate that the E6 targeting E6-associated protein (E6AP) is responsible for suppression.
21727188 Gain-of-function human STAT1 mutations impair IL-17 immunity and underlie chronic mucocutaneous candidiasis.
21714643 We identified heterozygous missense mutations in the DNA sequence encoding the coiled-coil (CC) domain of signal transducer and activator of transcription 1 (STAT1) in patients with autosomal dominant chronic mucocutaneous candidiasis.
21697347 Western blot and electrophoretic mobility-shift assays identified the interferon-stimulated gene factor-3 (ISGF-3) components STAT1 and IRF-9 as the proximal targets of human herpesvirus 8 vIRF-2 activity.
21690236 these findings implicate an important role for IFN-beta-mediated STAT1 activation in innate immune responses of vascular endothelium to R. conorii infection.
21674123 Pathway analysis of the genes with altered methylation patterns identified the involvement of a differentiation-related network of genes whose activity may be heavily regulated by STAT1 in breast tumorigenesis.
21593149 show that Ad infection disrupts the interaction between STAT1 and its cognate protein tyrosine phosphatase, TC45
21576370 Data show that the inhibition of histone deacetylases had no bearing on STAT1 acetylation and did not diminish STAT1 tyrosine phosphorylation.
21572044 Interferon-gamma-induced MD-2 protein expression and lipopolysaccharide (LPS) responsiveness in corneal epithelial cells is mediated by Janus tyrosine kinase-2 activation and direct binding of STAT1 protein to the MD-2 promoter.
21571862 Clinical selection of HDAC4-overexpressing tumor cells upon exposure to chemotherapy promotes STAT1 deacetylation and cancer cell survival.
21533215 single hCMV protein can trigger a pro-inflammatory host transcriptional response via an unexpected STAT1-dependent but IFN-independent mechanism and identify IE1 as a candidate determinant of hCMV pathogenicity.
21477834 The authors conclude that measles virus C protein suppresses IFN-gamma signaling pathway via inhibition of phosphorylated STAT1 dimerization.
21466707 Interferon alpha 2 regulates MAPK and STAT1 pathways in human hepatoma cells.
21372127 long range genomic interactions have a role in macrophage-specific up-regulation of apolipoprotein E gene expression by STAT1
21368418 There is ahyperactivation of the JAK-STAT1 signaling pathway and negative feedback down-regulation of SOCS-1 in skin and monocytes of patients with systemic lupus erythematosus.
21362620 Vaccinia virus VH1 is essential for dephosphorylation of STAT1 at tyrosine 701
21354905 STAT1 and STAT2 are involved in the growth inhibition of HepG2 cells induced by phosphatidylethanolamine.
21346151 Data suggest the STAT1-dependent signal integration between IFNgamma and TLR in ECs and VSMCs could result in amplification of pro-inflammatory responses in the damaged vessel and could be involved in the initiation and progression of atherosclerosis.
21321110 Up-regulation and sustained activation of Stat1 are essential for interferon-gamma (IFN-gamma)-induced dual oxidase 2 (Duox2) and dual oxidase A2 (DuoxA2) expression in human pancreatic cancer cell lines.
21311224 Stat1 acts to suppress Neu-mediated breast tumorigenesis through immune regulatory and tumor-site specific mechanisms.
21307288 Strong activation of Stat3, such as by interleukin (IL)-6 in inflamed tissue, results in release from regulatory T cell suppression, whereas functional suppression is restored upon concurrent activation of Stat1.
21303487 Phosphorylation of Ser(727) in STAT1 could be a potentially suitable new therapeutic target for Sjogren's syndrome patients to prevent the destruction of salivary glands.
21288140 We show persistent activation of the Th1 (interferon-gamma) signaling pathway markers STAT1 and interferon regulatory factor 1 (IRF1), in the small intestine of celiac disease children despite gluten-free diet.
21207025 exogenous IFN-gamma-mediated STAT1 activation is required to facilitate STAT1 binding to the TAP1 promoter in Squamous cell carcinoma of the head and neck cells
21115047 all of the phosphorylated STAT3 positive cells were also positive for phosphorylated STAT1, both of which could be inhibited by a JAK2/STAT inhibitor, AG490
21099673 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
21091911 results suggest that the PD-1 inhibitory pathway may negatively regulate IL-12 expression by limiting STAT-1 phosphorylation in monocytes/macrophages during chronic hepatitis C virus infection
21084836 A dual role of STAT1 requires both its non-transcriptional as well as it known transcriptional function.
21057861 mutation in the N-terminal part of STAT1 involved in causing mycobacterial disease.
21056555 concluded that the expression of RIG-G was independent on the classical JAK-STAT pathway, but could be greatly increased by it.
20980339 Observational study of gene-disease association. (HuGE Navigator)
20974984 Downstream of interferon (IFN)-gamma, interleukin (IL)-27, and STAT1-activating cytokines there are both STAT1 and T-bet-dependent pathways capable of suppressing Th17 responses.
20949125 SH2 of STAT1 induces HLA-I expression and improves IFN-gamma signaling.
20937272 Overexpression of STAT1-Y701A or K410/413A mutants in Rhek-1 keratinocytes largely inhibited apoptosis further supporting the importance of STAT1 phosphorylation and activity for IFNalpha-induced cell death.
20937132 Wild-type V protein of Urabe AM9 strain of mumps virus may be more efficient than its mutant to inactivate both the interferon signaling pathway and antiviral response due to differences in their finest molecular interaction with STAT proteins.
20841510 Homozygous missense mutation causes STAT1 deficiency impairing early but not late responses to interferons.
20833730 TNFalpha and IFNgamma synergistically enhance transcriptional activation of CXCL10 in human airway smooth muscle cells via STAT-1, NF-kappaB, and the transcriptional coactivator CREB-binding protein.
20832538 Gene expression profiling of STAT1 may be potential targets for the chemoprevention of posttransplantation urothelial carcinoma.
20829351 C/EBP{delta} and STAT-1 are required for TLR8 transcriptional activity.
20814891 Malignant pleural effusions of lung cancer patients with higher pStat1 changes after IFN-gamma stimulation were more resistant to cisplatin.
20810735 HCV infection enhances STAT1 expression but impairs nuclear translocation of IRF-7 and its downstream molecules. These impairments in the IFN-alpha signaling pathway may, in part, be responsible for establishment of chronic HCV infection.
20802378 Observational study of genetic testing. (HuGE Navigator)
20798561 Polymorphisms in the STAT1 gene are associated with hepatocellular carcinoma susceptibility.
20798561 Observational study of gene-disease association. (HuGE Navigator)
20662656 The activities of STAT-1 in regulating the inflammatory response suggest that it contributes to the conjunctival granulomas characteristic of sarcoidosis, but its expression is not specific for either sarcoidosis or all granulomatous conjunctival disease.
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20624457 Both metanephric progenitors and renal tumor cells utilize a STAT1-dependent mechanism for growth or survival.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20576130 Early malignant transformation through FAK and STAT1 networking in BRCA1 mutant ovarian epithelium.
20568281 HIV-1 activation of STAT1 and STAT3 in human brain microvascular endothelial cells is associated with induction of promoter activity of the interferon-stimulated response element (ISRE)/interferon-gamma-activated sequence (GAS).
20562129 This study has replicated associations to chronic obstructive pulmonary disease phenotypes in the STAT1, NFKBIB/SIRT2 and GC genes in two independent populations, the associations of the former two genes representing novel findings.
20523058 Cross-talk between TLR3 signaling and cytokines regulates the expression of CCL5 in airway epithelial cells. TNF-alpha activates NF-kappaB, in cooperation with TLR3 signaling. IFN-gamma stabilizes CCL5 mRNA up-regulated by TLR3, dependent on STAT-1.
20519510 Interleukin-27 induces a STAT1/3- and NF-kappaB-dependent proinflammatory cytokine profile in human monocytes
20503287 Observational study of gene-disease association. (HuGE Navigator)
20457620 IFNgamma restores breast cancer sensitivity to fulvestrant by regulating STAT1, IFN regulatory factor 1, NF-kappaB, BCL2 family members.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20428775 These data indicate for the first time a mechanism involving STAT1/2 upregulation under the transcriptional control of INF-alpha signaling after knockdown of miR-221/222 cluster in U251 glioma cells.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20403236 STAT2 may interact with IRF-9 in a STAT1-independent manner.
20380698 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20347693 Phosphorylated STAT1 is elevated during aneurysmal degeneration. Its loss is associated with a higher rate of acute aortic rupture and more extensive aneurysms in a mouse model of aortic dissection.
20345984 Activation of signal transducer and activator of transcription-1 (STAT-1) and differential expression of interferon-gamma and anti-inflammatory proteins in pelvic ileal pouches for ulcerative colitis and familial adenomatous polyposis.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20225206 In conclusion, this study found no evidence that p100 functions as a transcriptional coactivator for STAT1-dependent gene regulation.
20180146 Stat1 might play a role in late-stage melanoma progression. Interference with the Stat1 pathway could have therapeutic implications for late-stage melanoma patients.
20103601 Interleukin-29 binds to melanoma cells inducing Jak-STAT signal transduction and apoptosis
20098684 Both YES and STAT1 were verified as direct miR-145 targets
20093796 STAT1, but not STAT3, might also be one of the crucial signal transducers in the development of bronchial smooth muscle hyper-responsiveness
20065083 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20045654 Polymorphisms of STAT1 and STAT4 are associated with increased susceptibility, pathological advancement, and development of proteinuria in childhood IgA nephropathy.
20045654 Observational study of gene-disease association. (HuGE Navigator)
20011528 These data add the nucleolin-Stat1 complex as a novel functional partner for the cell differentiation program, which is uniquely poised to regulate the transcription machinery via Stat1 and nuclear metabolism via nucleolin.
19935876 Results show that Ets1 and Stat1 functionally interact to optimize ICAM-1 transcription.
19915608 MUC1 and STAT1 function in an auto-inductive loop, and activation of both MUC1 and the STAT1 pathway in breast tumors confers a poor prognosis for patients.
19915063 PGI(2) exerts anti-inflammatory action by inhibiting STAT1-induced cytokine production, in part by targeting the transactivation domain-induced recruitment of the histone acetylase CBP/p300.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19891767 STAT1-dependent expressional regulation of glycolysis suggests a potential role for STAT1 as a transcriptional modulator of genes responsible for the Warburg effect.
19857525 Less STAT1 methylation and subsequent increased STAT1-PIAS1 interaction are involved in the mechanism of the interferon alpha-antagonistic activity of hepatitis B virus.
19802007 Data show that JAK1/STAT-activating ligands, interleukin 10, IL20, IL24, and IL6 were expressed by senescent cells, supporting autocrine/paracrine activation of JAK1/STAT.
19801665 Data suggest that SPE B up-regulates procaspase 8 expression via the JAK2/STAT1 pathway.
19781967 Molecular dynamics simulations were performed in explicit water of the activated Stat3 homodimer, and also its closely related member of the STAT family, activated Stat1 homodimer.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19691533 chronic inflammatory demyelinating polyradiculoneuropathy(CDIP)patients with active disease showed higher pSTAT1, T-bet, & pSTAT3 in CD4(+) T-cells & monocytes than controls
19667270 Studies indicate that a better understanding of the mechanisms of dysregulation of the STAT pathway and leukemogenesis may serve as a basis for designing novel therapeutic strategies directed against STATs.
19656875 Venezuelan equine encephalitis virus VEEV interferes with STAT1 activation by the type I and II receptor complexes through distinct mechanisms.
19652026 Macrophage hepcidin expression is induced by the activation of STAT1 and NF-kappaB and the induction of C/EBPbeta expression.
19646959 These results indicate that IFNgamma-activated STAT1 functions as a negative regulator of HIF-1-dependent transcription in tumor cells.
19625176 Observational study of gene-disease association. (HuGE Navigator)
19622834 CP-SOCS1, analogous to endogenous SOCS1, interacted with components of the IFN-gamma signaling complex and functionally attenuated the phosphorylation of STAT1
19604093 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19596857 resistance of oral squamous carcinoma to IFNgamma is not due to deficiency in STAT1-dependent signaling but from a defect in the signaling component that mediates IFNgamma-induced down-regulation of CcnA2 and Cdk2 expression
19594299 the STAT1 gene is important in human circulating monocytes in the etiology of osteoporosis.
19594299 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19582813 IL-27 elicits interferon-like STAT1-mediated responses in hepatocytes and hepatoma cells.
19574556 Interferon-gamma induces prolyl hydroxylase (PHD)3 through a STAT1-dependent mechanism in human endothelial cells.
19561067 Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha.
19553685 a new role for mTOR and alpha4/PP2Ac in the control of STAT1 nuclear content, and the expression of interferon-gamma-sensitive genes involved in immunity and apoptosis.
19515782 P protein sequesters STAT1 in the nucleus and prevents its activation.
19508864 constitutive JAK2/STAT1 activation mediates endogenous BACE1 expression in neurons; inhibition of JAK2/STAT1 signaling abrogates basal levels of BACE1 expression and Abeta generation.
19502801 Stat1 protein is as a master regulator of Ras-mediated transformation, a property that is intimately affected by its phosphorylation at Y701 and S727.
19479051 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
19478064 Study concludes that the nuclear unphosphorylated STAT1 (U-STAT1) that accumulates in response to interferons (IFNs) maintains or increases the expression of a subset of IFN-induced genes independently of tyrosine-phosphorylated STAT1 (YP-STAT1).
19464956 Data show that STAT1 might play an important role in sarcoidosis.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19439556 STAT1 is involved in maintaining the viral latency observed in transformed B cells and regulating immunorecognition by EBV-specific T cells.
19437244 resistance to apoptosis is associated with Stat1-dependent production of IL6 and IL8 and suppression of 8, 9 and 3
19436109 recessive STAT1 deficiencies impaired the IL-27 and IFN-lambda1 signaling pathways, possibly contributing to the predisposition to bacterial and viral infections, respectively
19434718 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19424608 The results reveal that STAT1 is required to promote the tumor killing effect of STAT3 inhibition in Hhead and neck carcinoma cell.
19423540 Nine SNPs distributed across eight genetic regions (ALOX5, IRAK3, ITGB2, NCF2, NFKB1, SELP, SOD1, and STAT1) were associated with risk of glioma with P value of <0.01.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19404407 IRF-1, IRF-7, type I IFNs, and STAT1 form a signaling feedback loop that is critical in regulating TRAIL expression in HIV-1-infected macrophages.
19393742 these results suggest that IFNgamma induced STAT1 homodimers modulate the transcriptional repression of FXR gene in macrophages during inflammation-related cytokines.
19380416 The tight junction protein ZO-2 is involved in regulation of vascular smooth muscle cells growth control upon vascular injury that is mediated by the transcription factor Stat1.
19351818 Signal transducer and activator of transcription (STAT) 2 together with IFN regulatory factor (IRF)-9 can effectively drive the transcription of RIG-G gene by their functional interaction through a STAT1-independent manner.
19342095 cystatin B interacts with STAT-1 and the levels of STAT-1 tyrosine phosphorylation (but not serine phosphorylation) between uninfected and HIV-infected PM and MDM are differentially regulated.
19333953 Observational study of gene-disease association. (HuGE Navigator)
19279332 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19231233 IFNgamma-stimulated mast cells induce productions of inflammatory cytokines through PKC/p38/NF-kappaB and AP-1 pathways, not through classical JAK/STAT1 pathway, in mast cells
19223260 The results indicate that the GBP1, STAT1 and CXCL10 may be novel risk genes for the differentiation of PBM at the monocyte stage.
19211553 the dimeric quaternary structure of VH1 is essential for specific recognition of activated STAT1, which prevents its nuclear translocation, thus blocking interferon-gamma signal transduction and antiviral response
19171783 STAT1 acetylation induces binding of TCP45, which catalyzes dephosphorylation and latency of STAT1
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19124747 STAT1-activating cytokines interleukin (IL)-27 and interferon (IFN)-gamma amplify transforming growth factor (TGF)-beta-induced FOXP3 expression.
19100922 This is the first study reporting the overexpression of STAT1 in human clear cell and papillary RCC tissues.
19088846 STAT1 activation by six FGFR3 mutants associated with skeletal dysplasia undermines dominant role of STAT1 in FGFR3 signaling in cartilage.
19074829 human colon carcinoma cells silence IFN-gamma-activated IRF8 expression through MBD1-dependent and PIAS1-mediated inhibition of pSTAT1 function at the methylated IRF8 promoter
19046253 Altogether, data presented herein indicate that direct action of STAT1 on the IL-18BP promoter at the proximal GAS element is key to IL-18BP expression by IFN-gamma-stimulated DLD-1 colon carcinoma cells
19041714 Brucella controls host defenses by impairing macrophage responses to IFNgamma induced STAT1-CBP/P300 association.
19017763 STAT1 was expressed at higher levels in patients with diabetic nephropathy than in control subjects.
19012493 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19007958 The authors mapped STAT1 binding site in the N-terminal region of measle virus V protein and identified a minimal peptide of only 11 amino acids.
18989459 influenza A viruses suppress type I IFN signaling on the level of JAK/STAT activation
18950845 Observational study of gene-disease association. (HuGE Navigator)
18832710 SHP2 activation induced by HCMV infection is responsible for the down-regulation of IFN-gamma-induced STAT1 tyrosine phosphorylation.
18818378 STAT1 plays an important role in hyaluronan -mediated inflammatory processes.
18803832 Evidence for a role of STAT1 in genetic susceptibility to SLE was not detected
18803832 Observational study of gene-disease association. (HuGE Navigator)
18789440 IFN-gamma down-regulates ABCA1 expression by inhibiting LXRalpha in a JAK/STAT signaling pathway-dependent manner
18787531 Iron chelators and hypoxia mimetics inhibit IFNgamma-mediated Jak-STAT signaling
18787082 The relationship of histone methylation at distal and proximal regulatory elements was characterized by comparing ChIP-seq profiles for these histones and for STAT1 in the immortalized HeLa cell line, with and without interferon-gamma stimulation.
18775329 Results reveal that nuclear beta-arrestin1, acting as a scaffold for the dephosphorylation of STAT1, is an essential negative regulator of IFN-gamma signaling and participates in the IFN-gamma-induced cellular antiviral response.
18771758 ISRE, STAT1, and STAT2 have essential roles in the regulation of constitutive and IFN-alpha-mediated PD-1 expression in macrophages
18676680 Observational study of gene-disease association. (HuGE Navigator)
18660489 Observational study of gene-disease association. (HuGE Navigator)
18633131 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18591661 STAT1 constantly oscillated between different dimer conformations, whereby the abundance of the dimerization interfaces was determined by tyrosine phosphorylation.
18586252 high glucose and IFN gamma exert the synergistic effect on MMP-1 expression by enhancing STAT1 phosphorylation and STAT1 transcriptional activity in macrophages
18579584 STAT1-dependent pathway is not essential for repression of ICPO-null mutant herpes simplex virus type 1 in fibroblasts.
18566411 JAK/STAT-1 signaling pathway was necessary and sufficient to mediate the down-regulation of FcRn gene expression by IFN-gamma
18500930 Fludarabine, an antileukemic drug active against cells that express STAT-1, selectively kills M. avium-infected macrophages.
18483262 persistent activation of STAT1, STAT3, and STAT5 correlate with resistance to vorinostat in lymphoma cell lines
18463151 Epstein-Barr virus SM protein induces splicing of STAT1 at a novel 5' splice site, resulting in a STAT1 mRNA incapable of producing STAT1 alpha.
18424756 IL-27 activates monocytes via STAT1 and suppresses IL-10 production but the inflammatory functions of IL-27 are abrogated by TLRs and p38
18401423 Although STAT1 phosphorylation required JNK and p38MAPK activation, only JNK activation was essential for IRF1 promoter activation by Tie2-R849W.
18381204 KAP1 interacts with STAT1 and regulates IFN/STAT1-mediated IRF-1 gene expression in collaboration with HDACs.
18370868 These data define the role of the ISGF3 members in IFN-beta inhibitory signaling.
18348986 Stat1/3 directly controls promoter P1 of the CASR, and the Stats indirectly regulate promoter P2 of the CASR via Sp1/3 in response to IL-6
18338947 data show that genetic variants in the IRF-1 and Stat1 genes of the IFN pathway are associated with multiple sclerosis and hepatitis c virus infection.
18338947 Observational study of gene-disease association. (HuGE Navigator)
18305569 With maturation of melanocytes from junctional into dermal components of nevi, pSTAT1 expression increased, whereas pSTAT3 expression decreased.
18305014 STAT-1 is involved in the signal transduction mechanism associated with cysteinyl leukotriene receptor 1 activation, supporting the hypothesis that it may represent a key transduction pathway leading to enhanced eosinophil adhesiveness.
18280748 results show that IL-15 can improve the function of NK cells via up-regulating NKG2D expression, and also augmenting the expression of cytotoxic effector molecules and the phosphorylation of STAT1 and ERK1/2, which may also contribute the NK lysis
18225539 22 out of 46 glioblastomas (48%) were strongly positive for staining with a STAT-1 antibody.
18218993 Data demonstrate that human metapneumovirus can inhibit the interferon-alpha response through regulation of STAT1 phosphorylation, and provide important insight into the viral pathogenesis of hMPV infection in the respiratory tract.
18062835 Observational study of gene-disease association. (HuGE Navigator)
18035482 Induction of XAF1 by IFNbeta was mediated by the transcription regulator Stat1 through the ISRE site within the promoter region of XAF1 gene in colon cancer.
18003888 STAT1 plays an integral role in HIV-1-induced blood brain barrier damage and is relevant to viral neuropathogenesis.
18003888 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
17986321 psoriasin expression is transcriptionally suppressed by IFN-gamma; this effect is likely to be mediated by the activation of the STAT1 signaling pathway
17983380 Observational study of gene-disease association. (HuGE Navigator)
17983380 The polymorphism C39134A, located in a potentially cis acting regulatory element in STAT1 intron 24, was inversely related to total IgE levels and atopic sensitization in German children.
17938255 Following cell exposure to IL-15, phosphorylation of STAT5 was predominantly observed, whereas, following stimulation with IL-21, there was predominant STAT1 and STAT3 activation.
17933493 The induction of IFIT4 transcription by IFN-alpha depends upon sequential activation of PKCdelta, JNK and STAT1, and the influence of PKCdelta or JNK on IFN-alpha-mediated induction of IFIT4 is dependent upon the phosphorylation of STAT1 at Ser-727.
17928350 These findings suggest that Ebola virus VP24 inhibits interaction of PY-STAT1 with karyopherins alpha1, alpha5, or alpha6 by binding within the PY-STAT1 binding region of the karyopherins.
17918184 EGFR induces expression of IRF-1 via STAT1 and STAT3 activation leading to growth arrest of human cancer cells
17909067 Observational study of gene-disease association. (HuGE Navigator)
17897103 Ser727 has a critical role in co-ordination of STAT1 functions in cellular responses
17878351 TNF-alpha leads to stabilization of IFN-epsilon mRNA, increased IFN-epsilon synthesis, engagement of type I IFNRs, increased STAT1 expression and phosphorylation, and up-regulation of retinoic acid-inducible gene-I expression
17804871 STAT1 decoy oligonucleotides were also used to block STAT1 mRNA and led to a decrease in the levels of STAT1 and to subsequence decrease in the percentage of apoptosis induced by Diallyl disulfide in examined colo 205 cells
17726060 The onset of chromatin remodelling corresponds with the binding of activated STAT1 and the chromatin remodelling enzyme BRG1 at specific sites within the MHC, and is followed by RNA-polymerase recruitment and histone hyperacetylation.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17686504 Mealse virus V protein can block the direct phosphorylation of STAT1 by Jak1 to escape IFN alpha/beta signaling.
17680769 STAT1 gene is expressed in an individual and specific manner both in HPV-positive cervical tumors and cell lines harboring transforming genes of these viruses.
17640695 the V protein of SV5 functions as a bipartite adaptor linking DDB1 to STAT2, which in turn binds STAT1 and presents STAT1 to the E3 ligase complex for ubiquitination and subsequent degradation.
17617740 IFNalpha induces TRAIL expression via a STAT-1/IRF-1-dependent mechanism in human bladder cancer cells
17596301 Retention of import factors at the ER/Golgi membrane leads to a loss of STAT1 transport into the nucleus in response to interferon signaling, thus blocking the expression of STAT1-activated genes that establish an antiviral state.
17561467 Results suggest that a PLCgamma-STAT1 pathway mediates apoptotic signaling by FGFR3 in genetic dwarfism and chondrogenic cell lines.
17538964 presence of intracellular HCV antigens led to transcriptional and protein expression of IL-8 (CXCL-8), and impaired interferon induction of signal transducers and activators of transcription 1 (STAT1) serine and tyrosine and STAT2 tyrosine phosphorylation
17523873 STAT1 is required for interferon-inducible but not constitutive responsiveness to extracellular dsRNA.
17490620 This study represents the first microarray analysis for LQTS and implicates STAT1 in the pathogenesis and progression of LQTS and heart failure.
17486072 interferon-induced STAT1 activation is enhanced by EBNA1
17475642 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
17442890 A mutation in STAT2 that confers an apoptotic effect in tumor cells in response to type I interferons, is described.
17427945 Stat1 in complex with Stat3 and HSF1 bound at the GAS element led to a moderate heat shock induction, designated as an "intrinsic" induction of the hsp90alpha gene; a changed level of heat shock induction was also controlled by the Stat1 on hsp90alpha.
17386941 Non-tyrosine phosphorylated-Stat1 is involved in a cooperative interaction with Spi-1/PU.1 and IRF8 in the formation of a pre-associated, poised complex for interleukin 1-beta gene induction.
17371985 TGF-beta rapidly suppresses IFN-gamma-driven STAT1 signaling by reducing DNA binding via promotion of STAT1--PIAS1 interactions and not inhibition of STAT1 activation.
17346710 STAT1 and TA-p73 can interact directly, and p73-mediated Bax promoter activity was observed to be reduced by STAT1 expression in a p53-independent manner for which STAT1 Tyrosine-701 and Serine-727 are key residues.
17287281 products of the rabies virus P gene are able to counteract IFN signaling by creating both cytoplasmic and nuclear blocks for STAT1.
17266440 Stat1 does not couple to apoptosis of A549 non-small cell lung adenocarconima cells.
17237409 using choriocarcinoma cells, it is shown that tyrosine phosphatase mediated suppression of IFN-gamma-inducible JAK and STAT-1 and select IFN-gamma-inducible gene expression in trophoblast cells may contribute to fetal maintenance
17227821 These data suggest a mechanism of IC-mediated inhibition of IFN-gamma signaling, which requires the ITAM-containing FcgammaRI, as well as the ITIM-dependent phosphatase SHP-1, ultimately resulting in the suppression of STAT1 phosphorylation.
17196131 HCV NS5A can, to some extent, inhibit phosphorylation and nuclear translocation of STAT1 in IFN alpha-2b-induced JAK/STAT pathway.
17182865 When the tyrosine-phosphorylated STAT1 disengages from DNA, the N-terminal domain (ND) dimerizes and somehow assists in freeing the reciprocal binding between the monomers of the dimer while ND ND dimerization persists.
17145596 Expression of STAT1 in tumor-associated macrophages is an important independent prognostic factor for shorter overall survival in follicular lymphoma.
17075845 STAT-1alpha, especially Ser(727) pSTAT-1, may function as a key molecule in the pathogenesis of Sjogren syndrome
17030574 the amount of IFN-gamma-induced STAT-1 activation in C. psittaci infected cells paralleled that observed in uninfected cells, suggesting that STAT-1 activation by these newly expressed receptors was impaired.
16978698 These results suggest that RSV can inhibit the phosphorylation of IFN-alpha-inducible STAT1 and STAT2 by inducing the expression of SOCS proteins in PMA-treated U937 cells.
16951379 Stat1 exerts an inhibitory effect on early growth response (Egr)-1 gene and PDGF ligand mRNA transcription.
16940534 binding of HCV core to STAT1 results in decreased P-STAT, blocks STAT1 heterodimerization to STAT2, and, therefore, reduces IFN-stimulated gene factor-3 binding to DNA and disrupted IFN-stimulated gene transcription
16935931 observed a reperfusion time-dependent increase in the tyrosine phosphorylation of STAT1 and STAT3 at residues 701 and 705, respectively, which was dramatically reduced by tempol
16934001 STAT1 deficiency caused by mutations Q463H and E320Q which affect STAT1 DNA-binding activity.
16918696 Our data suggest that ATRA-induced regulation of Stat2, ICSBP and C/EBPepsilon is dependent on active Stat1, and that a failure to correctly regulate these transcription factors is associated with the inhibition of monocytic differentiation.
16904741 Phosphorylation in trophpoblasts or blood mononuclear cells are activated with lipopolysaccharide or phytohemagglutinins.
16897667 STAT1 alpha overexpression increases cell apoptosis and Fas ligand expression, compared with STAT1 beta overexpression and enhance release of cytochrome c from the mitochondria and caspase-3 activity.
16897667 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
16878149 This paper describes a previously unknown link between hypoxia and STAT1 expression down-regulation.
16878149 link between HIF-1 and STAT1 reveals a previously unknown role of STRA13 in hypoxia and carcinogenesis
16799645 Findings suggest that serine-phosphorylated STAT1, as a downstream target of protein kinase CK2, plays a critical role in the pathogenesis of Wilms' tumor and possibly other neoplasms with similar STAT1 phosphorylation patterns.
16773129 Neither the alleles, nor the genotypes in the case-control genetic association studies, nor the haplotype analysis showed any association to the STAT-1 gene in the Dutch coeliac disease population.
16703666 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
16628196 The STAT1-SOCS1 pathway regulates the innate immune response via TLR3 signaling in epidermal keratinocytes.
16585190 Data indicate that STAT1 plays a key role in the inhibition of angiogenesis through its action within vascular endothelial cells.
16574066 STAT-1alpha plays an important role in the atRA-induced transcriptional up-regulation of restin
16572323 Effect of signal transducer and activator of transcription 1 proteins on indomethacin-induced cell division inhibition in chronic myelogenous leukemia cells.
16571725 changes in the relative expression and activation of STAT1 and STAT3 that occur during immune responses determine the nature of cellular responses to type I IFNs
16512786 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1
16512786 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
16511123 X-ray crystallographic analysis of human STAT1
16501077 Rabies virus P protein inhibits interferon signaling via activation-dependent binding to STAT1 and STAT2
16481475 The acetylation of Stat1 regulates NF-kappaB activity and thus ultimately apoptosis.
16467883 We conclude that the rate of activation of Stat1 in cells by IFN-gamma can be modified by regulating either receptor chain and speculate that pharmacological agents which modify receptor chain expression may alter IFN-gamma receptor signal transduction.
16388135 over expression and purification of amino-terminal domain of STAT1; characterization by mass spectrometry and 2-dimensional nuclear magnetic resonance spectroscopy; results indicate that the N-terminus of hSTAT1 exists as a dimer in solution
16318585 TNF-alpha and IFN-gamma regulate gene transcription mediated by NF-kappaB-Stat1 interactions
16260419 protein kinase Cdelta and JNK have roles in Ifn-alpha induced expression of phospholipid scramblase 1 through STAT1
16257975 results demonstrate that the conserved Leu-724 residue is a key residue that controls the maximal transcription activities of Stat1 in IFN-gamma signaling
16254375 Rabies virus P protein does not induce STAT1 degradation and does not interfere with STAT1 phosphorylation. (Rabies virus P protein)
16223733 STAT1, IRF1, and NF-kappaB activation and early myocyte apoptosis play a mechanistic role in septic myocardial depression and sepsis-induced organ dysfunction
16195225 regulated nuclear export determines the cytokine sensitivity of the shuttling STAT1 transcription factors by controlling their availability at the receptor kinase complex
16148142 early vs late natures of the STAT1-dependent and STAT1-independent pathway responses in mice with primary DEN infection
16148108 IFNG priming enhances migration to inflammatory chemokines; IFN-gamma-inducible gene expression is attenuated by high levels of Stat1; physiological regulation of the relative abundance of Stat1 and Stat3 impacts on gene expression
16077199 Some antiapoptotic proteins were involved, but not STAT-1 alpha kinase, in resistance to TNF-alpha-dependent cell death promoting activity.
15998520 The hyperinsulinemia caused by this treatment may oppose the alterations in some gene expressions and the endothelial proliferation (cell growth-related gene expressions) that occur in established diabetes.
15996661 STAT1 and Nmi are downstream targets of Ets-1 in MCF-7 human breast cancer cells
15979846 results demonstrate for the first time that prostacyclin receptor activation by cicaprost can lead to STAT1 and STAT3 phosphorylations via signaling pathways involving pertussis toxin-insensitive G proteins, ERK and JNK
15919942 phosphorylation inhibited by human parainfluenza virus type 3 C protein.
15825084 HCV core protein binds STAT1, suggesting that this viral protein is associated with STAT1 degradation. STAT1 plays indispensable role in antiviral immunity against HCV expression. HCV subverts Jak-STAT kinase by selectively inducing STAT1 degradation.
15795279 LMP1-induced tyrosine phosphorylation of STAT1 is almost exclusively due to the NF-kappaB-dependent secretion of interferons in B cells. (stat1)
15778351 TPO and IFN-gamma activate the expression of TAP1 via a new mechanism that involves functional cooperation between STAT1 and IRF-2 on the TAP1 promoter
15650219 STAT1 activation and interferon signaling blocked by West Nile Virus nonstructural proteins
15638726 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
15604419 Coordinated Stat1 and NF-B activation, along with the lack of Stat3 activation, accounts for cytokine-stimulated GTPCH I induction in endothelial cells.
15527154 Observational study of gene-disease association. (HuGE Navigator)
15322115 Protein kinase Cdelta regulates apoptosis via activation of STAT1.
15280488 first 23 amino acids (C(1-23)) of the 204-amino-acid (aa)-long Sendai virus C protein act as an independent viral element that induce STAT1 degradation
15221897 IFN-alpha-induced nuclear accumulation of STAT1 was almost completely blocked in cell lines expressing high levels of HCV core protein.
15217838 imbalance between the antiproliferative/proapoptotic isoform STAT1alpha and the proliferative isoform STAT1beta is likely to play a crucial role in the regulation of proliferation and apoptosis
15213094 STAT1 plays an important role in the regulation of erythropoiesis.
15210729 Nuclear export by CRM1 created a nucleocytoplasmic Stat1 concentration gradient is significantly reduced by the blocking of energy-requiring translocation mechanisms
15165826 expression of STAT-1 induced by Epstein-Barr virus (EBV) LMP-1 (latent membrane protein) and associated with EBV transformation and may be part of regulation of viral latency and cellular transformation
15123634 STAT1 requires histone deacetylase activity for signaling
15055356 the IGF-I receptor gene is a novel target for STAT1 action and that at least part of the inhibitory effects of STAT1 may involve repression of the strongly antiapoptotic IGF-I receptor gene
15010467 the role of DNA binding in nuclear retention of Stat1; diminished N-domain-mediated oligomerization affected transcriptional activation by both Stat1 and Stat5a/b in a promoter-specific manner.
14976049 Epigenetic activation of the Jak/STAT pathway might have a tentative role in the pathogenesis of myeloma.
14755057 role of overexpression in tumors on radioresistance
14751560 Abnormally high amounts of Stat1, Stat5 and p21Cip1 proteins were found in prehypertrophic-hypertrophic chondrocytes, the extent of overexpression being directly related to the severity of the disease
14746803 Results demonstrate that induction of adenine nucleotide translocase 3 by interleukin-4 and interferon-gamma proceeds via pathways involving STAT6 and STAT1, respectively.
14690454 IFN-gamma inhibits IFN-alpha-activated signals partly through the induction of STAT1 protein expression. Overexpression blocks IFNA-activated STAT2 translocation from IFNA receptor 2 to IFNA receptor 1, a critical step in IFNA signalling activation.
14688135 interferon gamma Stat1 signaling in epithelial cells is disrupted by Helicobacter pylori infection
14657353 STAT1 has a role in IL-27 regulation of IL-12 responsiveness to naive CD4+ T cells
14656722 there is progressive dysregulation of nuclear factor-kappa B and STAT1 in prostate cancer cells that leads to proangiogenic production of CXC chemokines.
14654702 ZBP-89 binds directly to the STAT1 promoter G-rich element
14654078 On completion of fludarabine cycle 1, CLL cells showed increased STAT1 in the majority of patients, in contrast to the in vitro findings. This may reflect a survival advantage for cells that express high levels of STAT1
14623896 prolonged nuclear localization of activated STAT1 results in apoptosis involving specific regulation of caspase pathway
14600148 STAT1 tyrosine phosphorylation and DNA binding is dependent on Tc-PTP
14599788 Sendai virus C protein prevents the gamma-activated factor from binding to gamma-activated sequence elements through its interaction with the STAT1 N-terminal domain.
14557668 Hendra virus V protein inhibits cellular responses to IFN through binding and cytoplasmic sequestration of STAT1
14500749 NF-kappaB, STAT1, and IRF-1 within HVSMCs could be central to a number of vascular pathologies and that inhibition of this pathway could be of therapeutic benefit.
12967644 The results indicate that STAT1 activation play a crucial role in IFNalpha signaling for cytolysis function of NK cells.
12963127 Differentiation-dependent expression of STAT1 may modify responses to growth factors in the cancers of the head and neck
12948935 potential mechanism for reduced NOS2 expression in cystic fibrosis is diminished signal transducer and activator of transcription-1 (STAT1) activity, possibly due to an increase in expression of protein inhibitor of activated STAT1 (PIAS1
12923054 DNA-binding controls inactivation and nuclear accumulation of Stat1.
12917439 HSP27-dependent thermotolerance is suppressed by mumps virus infection through the destruction of STAT-1.
12856330 Interleukin-1 induces the phosphorylation of Stat1 on serine 727 but not on tyrosine 701
12855578 PIAS1 was found to strongly stimulate sumoylation of STAT1 at Lys703 by SUMO-1 conjugation to STAT1; results suggest a negative regulatory function for sumoylation.
12855573 STAT1 mediates differentiation of chronic lymphocytic leukemia cells in response to Bryostatin 1
12846741 STAT1 and STAT3 may, at least in part, mediate angiotensin II-induced TIMP-1 mRNA expression in human renal proximal tubular epithelial cells, implicating a role of the STAT signaling pathway in pathogenesis of renal tubulointerstitial fibrosis.
12832402 Stat1 and Stat3 exist as stable homodimers prior to activation
12807916 STAT1-dependent transcription of pro-apoptotic and pro-inflammatory genes is regulated by IFN-gamma activated PI3K and mTOR pathways in a rapamycin-insensitive manner
12804771 Measles virus V protein blocks INF-alpha/beta signaling by inhibiting STAT1 phosphorylation.
12788789 a physical interaction between c-Fos and STAT-1 participates in NOS2 gene transcriptional activation in lung epithelium
12777975 Data suggest there is no defect in the JAK/STAT pathway in the tested melanoma cell lines, and that interferon resistance must be mediated through other components.
12759242 Data suggest that persistent STAT-1 activation can contribute to maintaining and expanding the local inflammatory response in Celiac Disease.
12748293 Results provide evidence that interleukin-13 induces p38 MAP kinase phosphorylation and activation, which regulates Stat1 and Stat3 serine 727 phosphorylation.
12722480 EGF-induced phosphorylation diminished the amount of this protein found in the clonal variants of A431 cells.
12637327 results show that Ser727/Tyr701-phosphorylated Stat1 plays a key role as a prerequisite for the ATRA-induced down-regulation of c-Myc; cyclins A, B, D2, D3, and E; and simultaneous up-regulation of p27Kip1, associated with arrest in the G0/G1 phase
12634403 role for NFkappaB in LMP-1-mediated STAT1 expression in Epstein-Barr virus-immortalized cells
12629155 gp120 induces activation of STAT1, STAT3, and STAT5 in CD4+ cells of lymphocyte or monocyte/macrophage lineages.
12610144 Epstein-Barr virus SM protein induces STAT1 mRNA levels
12590259 We report two unrelated infants homozygous with respect to mutated STAT1 alleles. Both suffered from mycobacterial disease, but died of viral disease.
12551969 Amino-termnal extensions of Sendai Virus C proteins induce pY701-Stat1 formation (while decreasing bulk Stat1 levels) in a manner that does not require interferon signaling
12539042 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment
12459177 Data suggest that down-regulation of interferon-gamma-mediated nuclear STAT1 binding in hepatocytes involves both dephosphorylation by mitogen-activated protein kinase phosphatase 1 and degradation by the ubiquitin-dependent proteasome pathway.
12447867 Observational study of gene-environment interaction. (HuGE Navigator)
12388709 Nipah virus V protein evades alpha and gamma interferons by preventing STAT1 activation and nuclear accumulation
12270932 Stat1 phosphorylation is inhibited by SHP-2 and Stat1-dependent induction of luciferase activity is suppressed by SHP-2
12232802 Cells lacking STAT-1 show reduced apoptosis in response to heat or ischaemia. Expression of STAT-1 in these cells does not enhance cell death but restores sensitivity to stress-induced death.
12232043 STAT-dependent trans-activation is regulated by p38 MAPK and interferon gamma independent of serine phosphorylation
12223098 requirement in interferon-gamma-mediated inhibition in human chondrocytes
12191570 STAT-1, IRF-1, and RAR-beta expression were enhanced by IFN-gamma and ATRA in combination, and to a greater degree in BALM-3 cells than in BALM-1 cells, suggesting that these IFN-gamma related genes were involved in the induction of apoptosis.
12171910 STAT1 phosphorylation of TcPTP is regulated by arginine methylation
12165521 Lipid microdomains are required sites for the phosphorylation and nuclear translocation of STAT1alpha.
12161037 Excessive P-Tyr-STAT1 responses could induce inflammatory cytokines and demyelination in MS, as in motheaten mice, which have defects in SHP-1 function. Abnormal interferon signaling may predict the course of MS and responses to therapy.
12130529 Distinct functions for STAT1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter.
12048190 arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5
11981818 Block of Stat-1 activation in macrophages phagocytosing bacteria causes reduced transcription of CIITA and consequent impaired antigen presentation.
11972023 Requirement of Ca2+ and CaMKII for Stat1 Ser-727 phosphorylation in response to IFN-gamma
11932384 results constitute genetic and biochemical evidence supporting a paramyxovirus-induced, IFN-independent STAT protein degradation complex that contains at least STAT1 and STAT2
11909970 Stat1-vitamin D receptor interactions antagonize 1,25-dihydroxyvitamin D transcriptional activity and enhance stat1-mediated transcription.
11909852 Isolation and characterization of a human STAT1 gene regulatory element. Inducibility by interferon (IFN) types I and II and role of IFN regulatory factor-1.
11886859 identification as a molecular target of IGFBP-3 during chondrogenesis
11843291 Stat1 and Stat3 may support cell growth in part via c-myc gene activation in primary erythroleukemia cells.
11839738 phosphorylation on serine 727 by protein kinase C-delta
11835405 STAT1 plays a minimal role in TNF-mediated cellular responses
11815625 Cytokine signaling: STATS in plasma membrane rafts
11804954 IFNtau effect on IRF-1 expression is primarily regulated by tyrosine-phosphorylated Stat1alpha or Stat1beta dimers
11777927 We conclude that STAT1 activation is necessary but not sufficient for induction of transcription of IFN gamma-responsive genes
11752148 soluble factor(s) secreted from CD8(+) T lymphocytes inhibits human immunodeficiency virus type 1 replication through STAT1 activation
11675348 Monocyte-derived dendritic cells treated with HIV-1 gp120 (CCR5-tropic, CN54) upregulates STAT1 expression at 18 hours post-treatment

AA Sequence

MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSR      1 - 70
FSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQK     71 - 140
ELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKR    141 - 210
KEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKL    211 - 280
EELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK    281 - 350
LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN    351 - 420
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTP    421 - 490
PCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIES    491 - 560
ILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA    561 - 630
VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG    631 - 700
YIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV                        701 - 750
//

Text Mined References (648)

PMID Year Title
26966684 2016 PIPINO: A Software Package to Facilitate the Identification of Protein-Protein Interactions from Affinity Purification Mass Spectrometry Data.
26928402 2016 CD146 promotes metastasis and predicts poor prognosis of hepatocellular carcinoma.
26889034 2016 VP8, the Major Tegument Protein of Bovine Herpesvirus 1, Interacts with Cellular STAT1 and Inhibits Interferon Beta Signaling.
26795953 2016 PDGF-BB induces PRMT1 expression through ERK1/2 dependent STAT1 activation and regulates remodeling in primary human lung fibroblasts.
26747737 2016 Altered signaling in systemic juvenile idiopathic arthritis monocytes.
26719274 2015 Parainfluenza Virus 3 Blocks Antiviral Mediators Downstream of the Interferon Lambda Receptor by Modulating Stat1 Phosphorylation.
26678048 2015 The Inflammatory Transcription Factors NF?B, STAT1 and STAT3 Drive Age-Associated Transcriptional Changes in the Human Kidney.
26676844 2016 FAM172A modulates apoptosis and proliferation of colon cancer cells via STAT1 binding to its promoter.
26676749 2016 Identification of the Cell-Intrinsic and -Extrinsic Pathways Downstream of EGFR and IFN? That Induce PD-L1 Expression in Head and Neck Cancer.
26635038 2016 STAT1 activation in association with JAK2 exon 12 mutations.
26604104 2016 The Extended Clinical Phenotype of 26 Patients with Chronic Mucocutaneous Candidiasis due to Gain-of-Function Mutations in STAT1.
26592235 2016 Distal regulatory element of the STAT1 gene potentially mediates positive feedback control of STAT1 expression.
26560068 2016 Endothelial Cell Proteomic Response to Rickettsia conorii Infection Reveals Activation of the Janus Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT)-Inferferon Stimulated Gene (ISG)15 Pathway and Reprogramming Plasma Membrane Integrin/Cadherin Signaling.
26514428 2015 A novel gain-of-function STAT1 mutation resulting in basal phosphorylation of STAT1 and increased distal IFN-?-mediated responses in chronic mucocutaneous candidiasis.
26504087 2015 Reactive Oxygen Species (ROS) Mediate p300-dependent STAT1 Protein Interaction with Peroxisome Proliferator-activated Receptor (PPAR)-? in CD36 Protein Expression and Foam Cell Formation.
26502610 [Search of (-)-Cytisine Derivatives as Potential Inhibitors of NF-?B and STAT1].
26413796 2015 Ultraviolet light-emitting-diode irradiation inhibits TNF-? and IFN-?-induced expression of ICAM-1 and STAT1 phosphorylation in human keratinocytes.
26401035 2015 Infectious Bronchitis Coronavirus Inhibits STAT1 Signaling and Requires Accessory Proteins for Resistance to Type I Interferon Activity.
26397446 2015 Interferon-stimulated gene factor 3 complex is required for the induction of sterile ? motif and HD domain-containing protein 1 expression by interferon-? in SMMC-7721 cells.
26396258 2015 Selective targeting of JAK/STAT signaling is potentiated by Bcl-xL blockade in IL-2-dependent adult T-cell leukemia.
26362649 2015 Gene expression meta-analysis reveals immune response convergence on the IFN?-STAT1-IRF1 axis and adaptive immune resistance mechanisms in lymphoma.
26353965 2015 Suppression of type I and type III IFN signalling by NSs protein of severe fever with thrombocytopenia syndrome virus through inhibition of STAT1 phosphorylation and activation.
26351076 2015 STAT1 modification improves therapeutic effects of interferons on lung cancer cells.
26339056 2015 Structural Basis of the Inhibition of STAT1 Activity by Sendai Virus C Protein.
26335850 2015 STAT2-dependent induction of RNA adenosine deaminase ADAR1 by type I interferon differs between mouse and human cells in the requirement for STAT1.
26275341 2015 The two interfaces of the STAT1 N-terminus exhibit opposite functions in IFN?-regulated gene expression.
26255980 2015 Gain-of-function STAT1 mutations impair STAT3 activity in patients with chronic mucocutaneous candidiasis (CMC).
26242181 2015 Tumor-associated macrophages in oral premalignant lesions coexpress CD163 and STAT1 in a Th1-dominated microenvironment.
26238487 2015 The Raf Kinase Inhibitor Sorafenib Inhibits JAK-STAT Signal Transduction in Human Immune Cells.
26193702 2015 Type III Interferon Induces Distinct SOCS1 Expression Pattern that Contributes to Delayed but Prolonged Activation of Jak/STAT Signaling Pathway: Implications for Treatment Non-Response in HCV Patients.
26156524 2015 Regulation rewiring analysis reveals mutual regulation between STAT1 and miR-155-5p in tumor immunosurveillance in seven major cancers.
26119280 2015 Shp-2 contributes to anti-RSV activity in human pulmonary alveolar epithelial cells by interfering with the IFN-?-induced Jak/Stat1 pathway.
26113305 2015 Orf virus inhibits interferon stimulated gene expression and modulates the JAK/STAT signalling pathway.
26081906 2015 EBP1 protein modulates the expression of human MHC class II molecules in non-hematopoietic cancer cells.
26080282 2015 Recurrent inflammatory aortic aneurysms in chronic mucocutaneous candidiasis with a gain-of-function STAT1 mutation.
26028607 2015 Endothelial transcriptomic changes induced by oxidized low density lipoprotein disclose an up-regulation of Jak-Stat pathway.
26025667 2015 STAT1: A Novel Target of miR-150 and miR-223 Is Involved in the Proliferation of HTLV-I-Transformed and ATL Cells.
25972070 2015 STAT1-Induced HLA Class I Upregulation Enhances Immunogenicity and Clinical Response to Anti-EGFR mAb Cetuximab Therapy in HNC Patients.
25965795 2015 Identification of amino-acid residues in the V protein of peste des petits ruminants essential for interference and suppression of STAT-mediated interferon signaling.
25959715 2015 STS-1 promotes IFN-? induced autophagy by activating the JAK1-STAT1 signaling pathway in B cells.
25905045 2015 Comparative proteomic analyses demonstrate enhanced interferon and STAT-1 activation in reovirus T3D-infected HeLa cells.
25880788 2015 Defective trained immunity in patients with STAT-1-dependent chronic mucocutaneaous candidiasis.
25865496 2015 Lupus Risk Variant Increases pSTAT1 Binding and Decreases ETS1 Expression.
25847223 2015 IL-6 blockade reverses the abnormal STAT activation of peripheral blood leukocytes from rheumatoid arthritis patients.
25818476 2015 Interferon-? stimulates human follicular dendritic cell-like cells to produce prostaglandins via the JAK-STAT pathway.
25773877 2015 Expressional STAT3/STAT5 Ratio is an Independent Prognostic Marker in Colon Carcinoma.
25771902 2015 Immunohistochemical analysis of the expression of cellular transcription NF?B (p65), AP-1 (c-Fos and c-Jun), and JAK/STAT in leprosy.
25753288 2015 PI3k? and STAT1 Interplay Regulates Human Mesenchymal Stem Cell Immune Polarization.
25707685 2015 STAT1 single nucleotide polymorphisms and susceptibility to immune thrombocytopenia.
25686822 2015 Targeting EGF-receptor(s) - STAT1 axis attenuates tumor growth and metastasis through downregulation of MUC4 mucin in human pancreatic cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25589644 2015 Hepatitis C virus-mediated enhancement of microRNA miR-373 impairs the JAK/STAT signaling pathway.
25526807 2014 DNA binding reduces the dissociation rate of STAT1 dimers and impairs the interdimeric exchange of protomers.
25478796 2014 STAT1-dependent signal integration between IFN? and TLR4 in vascular cells reflect pro-atherogenic responses in human atherosclerosis.
25474274 2015 Suppression of epithelial signal transducer and activator of transcription 1 activation by extracts of Aspergillus fumigatus.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25438156 2014 Correlation of STAT1 with apoptosis and cell-cycle markers in esophageal squamous cell carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25355139 2014 The clinical and biological significance of STAT1 in esophageal squamous cell carcinoma.
25311665 2014 Suppressive oligodeoxynucleotides promote the generation of regulatory T cells by inhibiting STAT1 phosphorylation.
25293394 2015 Super-infection with Staphylococcus aureus inhibits influenza virus-induced type I IFN signalling through impaired STAT1-STAT2 dimerization.
25288569 2014 Two novel gain-of-function mutations of STAT1 responsible for chronic mucocutaneous candidiasis disease: impaired production of IL-17A and IL-22, and the presence of anti-IL-17F autoantibody.
25271158 2014 Glucocorticoid-induced S-adenosylmethionine enhances the interferon signaling pathway by restoring STAT1 protein methylation in hepatitis B virus-infected cells.
25267067 2014 STAT1 drives tumor progression in serous papillary endometrial cancer.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
25205818 2014 Differential effects of STAT proteins on growth hormone-mediated IGF-I gene expression.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25113744 2014 Altered phenotype and Stat1 expression in Toll-like receptor 7/8 stimulated monocyte-derived dendritic cells from patients with primary Sjögren's syndrome.
25104439 2014 Genetic variation in the JAK/STAT/SOCS signaling pathway influences breast cancer-specific mortality through interaction with cigarette smoking and use of aspirin/NSAIDs: the Breast Cancer Health Disparities Study.
25056900 2014 Inhibition of phosphorylated-STAT1 nuclear translocation and antiviral protein expression in human brain vascular adventitial fibroblasts infected with varicella-zoster virus.
25042743 2014 Gain-of-function mutations in signal transducer and activator of transcription 1 (STAT1): chronic mucocutaneous candidiasis accompanied by enamel defects and delayed dental shedding.
24992036 2014 G3BP1, G3BP2 and CAPRIN1 are required for translation of interferon stimulated mRNAs and are targeted by a dengue virus non-coding RNA.
24975396 2014 STAT of the union: dynamics of distinct tumor-associated macrophage subsets governed by STAT1.
24931237 2014 Three transcription factors and the way immune cells affected by different plasma change in opposite ways in the development of the syndrome of pre-eclampsia.
24894488 2014 Hes-1 SUMOylation by protein inhibitor of activated STAT1 enhances the suppressing effect of Hes-1 on GADD45? expression to increase cell survival.
24882218 2014 Unanchored K48-linked polyubiquitin synthesized by the E3-ubiquitin ligase TRIM6 stimulates the interferon-IKK? kinase-mediated antiviral response.
24878287 2014 STAT-1 expression is regulated by IGFBP-3 in malignant glioma cells and is a strong predictor of poor survival in patients with glioblastoma.
24858600 2014 STAT1 regulates MD-2 expression in monocytes of sepsis via miR-30a.
24847715 2014 A conserved motif in the linker domain of STAT1 transcription factor is required for both recognition and release from high-affinity DNA-binding sites.
24838635 2014 Signal transducer and activator of transcription 1 (STAT1) acts like an oncogene in malignant pleural mesothelioma.
24825907 2014 Transcriptional regulation of oncogenic protein kinase C? (PKC?) by STAT1 and Sp1 proteins.
24821973 2014 Vitamin D receptor and Jak-STAT signaling crosstalk results in calcitriol-mediated increase of hepatocellular response to IFN-?.
24814927 2014 Rotavirus inhibits IFN-induced STAT nuclear translocation by a mechanism that acts after STAT binding to importin-?.
24810717 2014 Caspase-3 and caspase-6 cleave STAT1 in leukemic cells.
24769842 2014 Decreased expression of NKG2D, NKp46, DNAM-1 receptors, and intracellular perforin and STAT-1 effector molecules in NK cells and their dim and bright subsets in metastatic melanoma patients.
24725474 2014 High STAT1 mRNA levels but not its tyrosine phosphorylation are associated with macrophage infiltration and bad prognosis in breast cancer.
24715035 2014 Gene expression changes in cancellous bone of type 2 diabetics: a biomolecular basis for diabetic bone disease.
24693969 2014 Engagement of immune effector cells by trastuzumab induces HER2/ERBB2 downregulation in cancer cells through STAT1 activation.
24681956 2015 B-cell lymphoma/leukemia 10 promotes oral cancer progression through STAT1/ATF4/S100P signaling pathway.
24658320 2014 Differential expression of STAT1 and p21 proteins predicts pancreatic cancer progression and prognosis.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24626739 2014 Phosphorylated signal transducer and activator of transcription 1 is a potential predictor of interferon response in patients with advanced renal cell carcinoma.
24562503 2015 Decreased expression of miR-146a and miR-155 contributes to an abnormal Treg phenotype in patients with rheumatoid arthritis.
24478085 2014 Toxoplasma gondii Inhibits gamma interferon (IFN-?)- and IFN-?-induced host cell STAT1 transcriptional activity by increasing the association of STAT1 with DNA.
24454965 2014 A co-culture model of the developing small intestine offers new insight in the early immunomodulation of enterocytes and macrophages by Lactobacillus spp. through STAT1 and NF-kB p65 translocation.
24451065 2014 Elevated signal transducers and activators of transcription 1 correlates with increased C-C motif chemokine ligand 2 and C-X-C motif chemokine 10 levels in peripheral blood of patients with systemic lupus erythematosus.
24449862 2014 Novel antiviral host factor, TNK1, regulates IFN signaling through serine phosphorylation of STAT1.
24360797 2014 Hepatic RIG-I predicts survival and interferon-? therapeutic response in hepatocellular carcinoma.
24343863 2014 Simple diagnosis of STAT1 gain-of-function alleles in patients with chronic mucocutaneous candidiasis.
24292724 2014 Positive correlation of STAT1 and miR-146a with anemia in patients with systemic lupus erythematosus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24239102 2014 Fatal combined immunodeficiency associated with heterozygous mutation in STAT1.
24188975 2014 Penicillium marneffei infection and impaired IFN-? immunity in humans with autosomal-dominant gain-of-phosphorylation STAT1 mutations.
24086752 2013 STAT1 regulates human glutaminase 1 promoter activity through multiple binding sites in HIV-1 infected macrophages.
24065129 2013 IFN?-dependent increases in STAT1, STAT2, and IRF9 mediate resistance to viruses and DNA damage.
23984931 2013 Probucol inhibits JAK2-STAT pathway activation and protects human glomerular mesangial cells from tert-butyl hydroperoxide induced premature senescence.
23958647 2013 IL-4 confers resistance to IL-27-mediated suppression on CD4+ T cells by impairing signal transducer and activator of transcription 1 signaling.
23950992 2013 Dendritic cells from Crohn's disease patients show aberrant STAT1 and STAT3 signaling.
23943785 2013 Acacetin inhibits in vitro and in vivo angiogenesis and downregulates Stat signaling and VEGF expression.
23941832 2013 Tumoricidal effects of the JAK inhibitor Ruxolitinib (INC424) on hepatocellular carcinoma in vitro.
23940278 2013 Ubiquitin-specific protease 13 regulates IFN signaling by stabilizing STAT1.
23922848 2013 Clinically relevant dimer interface mutants of STAT1 transcription factor exhibit differential gene expression.
23920124 2013 Guggulsterone decreases proliferation and metastatic behavior of pancreatic cancer cells by modulating JAK/STAT and Src/FAK signaling.
23917355 2013 Cancer upregulated gene 2, a novel oncogene, enhances migration and drug resistance of colon cancer cells via STAT1 activation.
23910645 2013 Protein phosphatase 2A impairs IFN?-induced antiviral activity against the hepatitis C virus through the inhibition of STAT1 tyrosine phosphorylation.
23890093 2014 miR146a impairs the IFN-induced anti-HBV immune response by downregulating STAT1 in hepatocytes.
23856440 2013 The measles virus phosphoprotein interacts with the linker domain of STAT1.
23796786 2014 Skin microbiome imbalance in patients with STAT1/STAT3 defects impairs innate host defense responses.
23756862 2013 Both STAT1 and STAT3 are favourable prognostic determinants in colorectal carcinoma.
23741352 2013 Zoledronic acid sensitizes renal cell carcinoma cells to radiation by downregulating STAT1.
23740952 2013 Synergistic expression of the CXCL10 gene in response to IL-1? and IFN-? involves NF-?B, phosphorylation of STAT1 at Tyr701, and acetylation of histones H3 and H4.
23709754 2013 New and recurrent gain-of-function STAT1 mutations in patients with chronic mucocutaneous candidiasis from Eastern and Central Europe.
23708675 2013 Molecular genetic characterization of p53 mutated oropharyngeal squamous cell carcinoma cells transformed with human papillomavirus E6 and E7 oncogenes.
23704922 2013 IL-26 promotes the proliferation and survival of human gastric cancer cells by regulating the balance of STAT1 and STAT3 activation.
23703473 2013 Aspirin enhances IFN-?-induced growth inhibition and apoptosis of hepatocellular carcinoma via JAK1/STAT1 pathway.
23621408 2013 Interleukin (IL)-31 activates signal transducer and activator of transcription (STAT)-1, STAT-5 and extracellular signal-regulated kinase 1/2 and down-regulates IL-12p40 production in activated human macrophages.
23609054 2013 Transcription factor STAT1 gene polymorphism is associated with the development of severe forms of periodontal disease.
23588992 2013 STAT1 negatively regulates hepatocellular carcinoma cell proliferation.
23585529 2013 Heterozygosity for the Y701C STAT1 mutation in a multiplex kindred with multifocal osteomyelitis.
23585528 2013 Elevated levels of STAT1 in Fanconi anemia group A lymphoblasts correlate with the cells' sensitivity to DNA interstrand crosslinking drugs.
23582260 2013 Evidence against a role for ?-arrestin1 in STAT1 dephosphorylation and the inhibition of interferon-? signaling.
23554911 2013 Up-regulation of intestinal epithelial cell derived IL-7 expression by keratinocyte growth factor through STAT1/IRF-1, IRF-2 pathway.
23541320 2013 Signal transducer and activator of transcription 1 (STAT1) gain-of-function mutations and disseminated coccidioidomycosis and histoplasmosis.
23534974 2013 Dominant gain-of-function STAT1 mutations in FOXP3 wild-type immune dysregulation-polyendocrinopathy-enteropathy-X-linked-like syndrome.
23487038 2013 BAL1/ARTD9 represses the anti-proliferative and pro-apoptotic IFN?-STAT1-IRF1-p53 axis in diffuse large B-cell lymphoma.
23486482 2013 Tumor STAT1 transcription factor activity enhances breast tumor growth and immune suppression mediated by myeloid-derived suppressor cells.
23472246 2013 The role of hepatic expression of STAT1, SOCS3 and PIAS1 in the response of chronic hepatitis C patients to therapy.
23471820 2013 TYK2-STAT1-BCL2 pathway dependence in T-cell acute lymphoblastic leukemia.
23452095 2013 IL-27 inhibits lymphatic endothelial cell proliferation by STAT1-regulated gene expression.
23403048 2013 Gain-of-function STAT1 mutations are associated with PD-L1 overexpression and a defect in B-cell survival.
23401241 2013 Loss of TIMP3 underlies diabetic nephropathy via FoxO1/STAT1 interplay.
23378427 2013 Evidence for postinitiation regulation of mRNA biogenesis in tuberculosis.
23363816 2013 SHP2 is overexpressed and inhibits pSTAT1-mediated APM component expression, T-cell attracting chemokine secretion, and CTL recognition in head and neck cancer cells.
23349666 2013 Phosphorylation of STAT-1 serine 727 is prolonged in HLA-B27-expressing human monocytic cells.
23306614 2013 Cancer upregulated gene 2, a novel oncogene, confers resistance to oncolytic vesicular stomatitis virus through STAT1-OASL2 signaling.
23274199 2013 Humanised antihuman IL-6R antibody with interferon inhibits renal cell carcinoma cell growth in vitro and in vivo through suppressed SOCS3 expression.
23271704 2013 Induction of BAFF expression by IFN-? via JAK/STAT signaling pathways in human intestinal epithelial cells.
23240025 2012 Toxoplasma gondii clonal strains all inhibit STAT1 transcriptional activity but polymorphic effectors differentially modulate IFN? induced gene expression and STAT1 phosphorylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23180800 2013 STAT1:DNA sequence-dependent binding modulation by phosphorylation, protein:protein interactions and small-molecule inhibition.
23154639 2012 STAT1, STAT6 and adenosine 3',5'-cyclic monophosphate (cAMP) signaling drive SOCS3 expression in inactive ulcerative colitis.
23153456 2013 IFN? converts IL-22 into a cytokine efficiently activating STAT1 and its downstream targets.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23108375 2013 SOCS-3 is downregulated in progressive CKD patients and regulates proliferation in human renal proximal tubule cells in a STAT1/3 independent manner.
23086340 2013 STAT1 activation by venous malformations mutant Tie2-R849W antagonizes VEGF-A-mediated angiogenic response partly via reduced bFGF production.
23076242 2012 The ebolavirus VP24 interferon antagonist: know your enemy.
23072252 2013 Adherent-invasive Escherichia coli blocks interferon-?-induced signal transducer and activator of transcription (STAT)-1 in human intestinal epithelial cells.
23068100 2012 Opposing roles of STAT-1 and STAT-3 in regulating vascular endothelial growth factor expression in vascular smooth muscle cells.
23043228 2012 Structure-function analysis indicates that sumoylation modulates DNA-binding activity of STAT1.
22973045 2012 Double-stranded RNA induces biphasic STAT1 phosphorylation by both type I interferon (IFN)-dependent and type I IFN-independent pathways.
22942432 2012 Selective sequestration of STAT1 in the cytoplasm via phosphorylated SHP-2 ameliorates murine experimental colitis.
22920460 2012 Two glutamic acid residues in the DNA-binding domain are engaged in the release of STAT1 dimers from DNA.
22844427 2012 A novel viral SOCS from infectious spleen and kidney necrosis virus: interacts with Jak1 and inhibits IFN-? induced Stat1/3 activation.
22838736 2012 Stat1 activation attenuates IL-6 induced Stat3 activity but does not alter apoptosis sensitivity in multiple myeloma.
22828446 2013 Immunosuppressive CD14+HLA-DRlow/neg IDO+ myeloid cells in patients following allogeneic hematopoietic stem cell transplantation.
22811740 2012 Involvement of Stat1 in the phagocytosis of M. avium.
22808166 2012 STAT1 interacts with RXR? to upregulate ApoCII gene expression in macrophages.
22805310 2012 Unphosphorylated STAT1 promotes sarcoma development through repressing expression of Fas and bad and conferring apoptotic resistance.
22757586 2012 Mathematical modelling unravels regulatory mechanisms of interferon-?-induced STAT1 serine-phosphorylation and MUC4 expression in pancreatic cancer cells.
22748593 2012 Herpes in STAT1 gain-of-function mutation [corrected].
22748021 2013 Progesterone activates Janus Kinase 1/2 and activators of transcription 1 (JAK1-2/STAT1) pathway in human spermatozoa.
22730530 2012 Chronic mucocutaneous candidiasis caused by a gain-of-function mutation in the STAT1 DNA-binding domain.
22693070 2013 STAT1 gene expression is enhanced by nuclear EGFR and HER2 via cooperation with STAT3.
22674974 2012 Hepatitis C virus NS5A disrupts STAT1 phosphorylation and suppresses type I interferon signaling.
22573496 2012 Dominant-negative STAT1 SH2 domain mutations in unrelated patients with Mendelian susceptibility to mycobacterial disease.
22558273 2012 The HIV matrix protein p17 subverts nuclear receptors expression and induces a STAT1-dependent proinflammatory phenotype in monocytes.
22539792 2012 Dendritic cells activated by IFN-?/STAT1 express IL-31 receptor and release proinflammatory mediators upon IL-31 treatment.
22535619 2013 Increased suppressor of cytokine signaling-3 expression predicts mucosal relapse in ulcerative colitis.
22526675 2012 Enterohemorrhagic Escherichia coli O157:H7 Shiga toxins inhibit gamma interferon-mediated cellular activation.
22514085 2012 Association between STAT1 activity and BRAF mutations in papillary thyroid carcinomas.
22488367 2012 Suppression of signal transducers and activators of transcription 1 in hepatocellular carcinoma is associated with tumor progression.
22479354 2012 Interferon-? regulates glutaminase 1 promoter through STAT1 phosphorylation: relevance to HIV-1 associated neurocognitive disorders.
22437822 2012 A novel STAT1 mutation associated with disseminated mycobacterial disease.
22425562 2012 Histone deacetylase inhibitors block IFN?-induced STAT1 phosphorylation.
22401175 2012 Gene expression analysis of rheumatoid arthritis synovial lining regions by cDNA microarray combined with laser microdissection: up-regulation of inflammation-associated STAT1, IRF1, CXCL9, CXCL10, and CCL5.
22383882 2012 The ebola virus interferon antagonist VP24 directly binds STAT1 and has a novel, pyramidal fold.
22381273 2012 Expression and activation of STAT family proteins in cerebral arteriovenous malformations.
22326919 2012 Cytokine-induced human islet cell death in vitro correlates with a persistently high phosphorylation of STAT-1, but not with NF-?B activation.
22320867 2012 Prognostic significance of phosphorylated STAT-1 expression in premenopausal and postmenopausal patients with invasive breast cancer.
22262126 2012 Inhibition of STAT1 sensitizes renal cell carcinoma cells to radiotherapy and chemotherapy.
22253910 2012 Identifying mechanisms by which Escherichia coli O157:H7 subverts interferon-? mediated signal transducer and activator of transcription-1 activation.
22242177 2012 Expression signature of IFN/STAT1 signaling genes predicts poor survival outcome in glioblastoma multiforme in a subtype-specific manner.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22217266 2012 Losartan inhibits STAT1 activation and protects human glomerular mesangial cells from angiotensin II induced premature senescence.
22195034 2011 STAT1 hyperphosphorylation and defective IL12R/IL23R signaling underlie defective immunity in autosomal dominant chronic mucocutaneous candidiasis.
22194871 2011 IL-7 promotes CD95-induced apoptosis in B cells via the IFN-?/STAT1 pathway.
22193460 2012 STAT1 mediates cellular senescence induced by angiotensin II and H?O? in human glomerular mesangial cells.
22178447 2012 Stat1 and CD74 overexpression is co-dependent and linked to increased invasion and lymph node metastasis in triple-negative breast cancer.
22174846 2011 Hepatic STAT1-nuclear translocation and interleukin 28B polymorphisms predict treatment outcomes in hepatitis C virus genotype 1-infected patients.
22115721 2012 Potency determination of recombinant IFN-alpha based on phosphorylated STAT1 using flow cytometry.
22065572 2011 Inhibitor of ?B kinase epsilon (IKK(epsilon)), STAT1, and IFIT2 proteins define novel innate immune effector pathway against West Nile virus infection.
22038351 2011 Interleukin-10 is expressed in HepG2.2.15 cells and regulated by STAT1 pathway.
22025054 2011 Transcriptional regulation of macrophage polarization: enabling diversity with identity.
22022391 2011 PCBP2 enhances the antiviral activity of IFN-? against HCV by stabilizing the mRNA of STAT1 and STAT2.
22002246 2011 A novel disrupter of telomere silencing 1-like (DOT1L) interaction is required for signal transducer and activator of transcription 1 (STAT1)-activated gene expression.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21937453 2011 Cytokines tumor necrosis factor-? and interferon-? induce pancreatic ?-cell apoptosis through STAT1-mediated Bim protein activation.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21796151 2011 IL-17A upregulates keratin 17 expression in keratinocytes through STAT1- and STAT3-dependent mechanisms.
21795355 2011 Deletion of Kaposi's sarcoma-associated herpesvirus FLICE inhibitory protein, vFLIP, from the viral genome compromises the activation of STAT1-responsive cellular genes and spindle cell formation in endothelial cells.
21772053 2011 Severe impairment of IFN-? and IFN-? responses in cells of a patient with a novel STAT1 splicing mutation.
21752694 2011 STAT1 as a novel therapeutical target in pro-atherogenic signal integration of IFN?, TLR4 and IL-6 in vascular disease.
21734056 2011 Suppression of STAT-1 expression by human papillomaviruses is necessary for differentiation-dependent genome amplification and plasmid maintenance.
21727188 2011 Gain-of-function human STAT1 mutations impair IL-17 immunity and underlie chronic mucocutaneous candidiasis.
21714643 2011 STAT1 mutations in autosomal dominant chronic mucocutaneous candidiasis.
21697347 2011 Kaposi's sarcoma-associated herpesvirus viral interferon regulatory factor-2 inhibits type 1 interferon signalling by targeting interferon-stimulated gene factor-3.
21690236 2011 Beta interferon-mediated activation of signal transducer and activator of transcription protein 1 interferes with Rickettsia conorii replication in human endothelial cells.
21674123 2011 Differential methylation hybridization profiling identifies involvement of STAT1-mediated pathways in breast cancer.
21593149 2011 Adenovirus sequesters phosphorylated STAT1 at viral replication centers and inhibits STAT dephosphorylation.
21576370 2011 STAT1 signaling is not regulated by a phosphorylation-acetylation switch.
21572044 2011 Interferon-gamma-induced MD-2 protein expression and lipopolysaccharide (LPS) responsiveness in corneal epithelial cells is mediated by Janus tyrosine kinase-2 activation and direct binding of STAT1 protein to the MD-2 promoter.
21571862 2011 HDAC4-regulated STAT1 activation mediates platinum resistance in ovarian cancer.
21533215 2011 Human cytomegalovirus IE1 protein elicits a type II interferon-like host cell response that depends on activated STAT1 but not interferon-?.
21477834 2011 Measles virus C protein suppresses gamma-activated factor formation and virus-induced cell growth arrest.
21466707 2011 Interferon alpha regulates MAPK and STAT1 pathways in human hepatoma cells.
21372127 2011 Macrophage-specific up-regulation of apolipoprotein E gene expression by STAT1 is achieved via long range genomic interactions.
21368418 2011 Activation of JAK-STAT1 signal transduction pathway in lesional skin and monocytes from patients with systemic lupus erythematosus.
21362620 2011 Dimerization of Vaccinia virus VH1 is essential for dephosphorylation of STAT1 at tyrosine 701.
21354905 2011 [STAT1 and STAT2 participate in growth inhibition of human hepatoma HepG2 cells induced by phosphatidylethanolamine].
21346151 2011 STAT1-mediated signal integration between IFN? and LPS leads to increased EC and SMC activation and monocyte adhesion.
21321110 2011 Up-regulation and sustained activation of Stat1 are essential for interferon-gamma (IFN-gamma)-induced dual oxidase 2 (Duox2) and dual oxidase A2 (DuoxA2) expression in human pancreatic cancer cell lines.
21311224 2011 Stat1 is a suppressor of ErbB2/Neu-mediated cellular transformation and mouse mammary gland tumor formation.
21307288 2011 Stat3 phosphorylation mediates resistance of primary human T cells to regulatory T cell suppression.
21303487 2011 Importance of serine727 phosphorylated STAT1 in IFN?-induced signaling and apoptosis of human salivary gland cells.
21288140 2011 The effect of gluten-free diet on Th1-Th2-Th3-associated intestinal immune responses in celiac disease.
21269460 2011 Initial characterization of the human central proteome.
21268089 2011 Molecular mechanisms underlying the inhibition of IFN-?-induced, STAT1-mediated gene transcription in human macrophages by simvastatin and agonists of PPARs and LXRs.
21207025 2011 Deficiency of activated STAT1 in head and neck cancer cells mediates TAP1-dependent escape from cytotoxic T lymphocytes.
21135090 2011 Mechanisms of STAT protein activation by oncogenic KIT mutants in neoplastic mast cells.
21115047 2011 IL-27 induces the differentiation of Tr1-like cells from human naive CD4+ T cells via the phosphorylation of STAT1 and STAT3.
21091911 2011 PD-1 negatively regulates interleukin-12 expression by limiting STAT-1 phosphorylation in monocytes/macrophages during chronic hepatitis C virus infection.
21084836 2010 STAT1 interacts directly with cyclin D1/Cdk4 and mediates cell cycle arrest.
21057861 2011 Novel STAT1 alleles in a patient with impaired resistance to mycobacteria.
21056555 2011 Intact JAK-STAT signaling pathway is a prerequisite for STAT1 to reinforce the expression of RIG-G gene.
20980339 2011 Hepatitis B viraemia: its heritability and association with common genetic variation in the interferon gamma signalling pathway.
20974984 2010 STAT1-activating cytokines limit Th17 responses through both T-bet-dependent and -independent mechanisms.
20949125 2010 SH2 modified STAT1 induces HLA-I expression and improves IFN-? signaling in IFN-? resistant HCV replicon cells.
20937272 2011 Activation of STAT1 is required for interferon-alpha-mediated cell death.
20937132 2010 Interaction of mumps virus V protein variants with STAT1-STAT2 heterodimer: experimental and theoretical studies.
20861313 2010 STAT1 is required for redifferentiation during Madin-Darby canine kidney tubulogenesis.
20841510 2010 A novel form of human STAT1 deficiency impairing early but not late responses to interferons.
20833730 2010 TNF? and IFN? synergistically enhance transcriptional activation of CXCL10 in human airway smooth muscle cells via STAT-1, NF-?B, and the transcriptional coactivator CREB-binding protein.
20832538 2010 Signal transducer and activator of transcription 1 and matrix metalloproteinase 3 genetic expression and clinical significance on urothelial tumors after renal transplantation.
20829351 2010 C/EBP{delta} and STAT-1 are required for TLR8 transcriptional activity.
20814891 2010 Single cell phospho-specific flow cytometry can detect dynamic changes of phospho-Stat1 level in lung cancer cells.
20810735 2010 Hepatitis C virus infection impairs IRF-7 translocation and Alpha interferon synthesis in immortalized human hepatocytes.
20802378 2010 A multiplex MALDI-TOF MS approach facilitates genotyping of DNA from formalin-fixed paraffin-embedded tumour specimens.
20798561 2010 Association of genetic polymorphisms in STAT1 gene with increased risk of hepatocellular carcinoma.
20662656 2010 The expression of STAT-1 and phosphorylated STAT-1 in conjunctival granulomas.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20624457 2010 STAT1 activation regulates proliferation and differentiation of renal progenitors.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20576130 2010 Activated networking of platelet activating factor receptor and FAK/STAT1 induces malignant potential in BRCA1-mutant at-risk ovarian epithelium.
20568281 2010 Cross-talk between STAT1 and PI3K/AKT signaling in HIV-1-induced blood-brain barrier dysfunction: role of CCR5 and implications for viral neuropathogenesis.
20562129 2011 Candidate genes for COPD in two large data sets.
20523058 2010 Cooperative activation of CCL5 expression by TLR3 and tumor necrosis factor-alpha or interferon-gamma through nuclear factor-kappaB or STAT-1 in airway epithelial cells.
20519510 2010 Interleukin-27 induces a STAT1/3- and NF-kappaB-dependent proinflammatory cytokine profile in human monocytes.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20457620 2010 IFNgamma restores breast cancer sensitivity to fulvestrant by regulating STAT1, IFN regulatory factor 1, NF-kappaB, BCL2 family members, and signaling to caspase-dependent apoptosis.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20428775 2010 Global changes of mRNA expression reveals an increased activity of the interferon-induced signal transducer and activator of transcription (STAT) pathway by repression of miR-221/222 in glioblastoma U251 cells.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20403236 2010 [A novel molecular mechanism of interferon alpha-regulated expression of retinoic acid-induced gene G].
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20347693 2010 Loss of STAT1 is associated with increased aortic rupture in an experimental model of aortic dissection and aneurysm formation.
20345984 2010 Activation of signal transducer and activator of transcription-1 (STAT-1) and differential expression of interferon-gamma and anti-inflammatory proteins in pelvic ileal pouches for ulcerative colitis and familial adenomatous polyposis.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20225206 2010 Coactivator P100 protein enhances STAT6-dependent transcriptional activation but has no effect on STAT1-mediated gene transcription.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20180146 2010 Tumor-promoting role of signal transducer and activator of transcription (Stat)1 in late-stage melanoma growth.
20103601 2010 Interleukin-29 binds to melanoma cells inducing Jak-STAT signal transduction and apoptosis.
20098684 2010 MicroRNA-145 targets YES and STAT1 in colon cancer cells.
20093796 2009 Activation of signal transducer and activator of transcription factor 1 by interleukins-13 and -4 in cultured human bronchial smooth muscle cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20065083 2010 A polymorphism associated with STAT3 expression and response of chronic myeloid leukemia to interferon ?.
20045654 2010 Polymorphisms of signal transducers and activators of transcription 1 and 4 (STAT1 and STAT4) contribute to progression of childhood IgA nephropathy.
20011528 2009 Stat1 nuclear translocation by nucleolin upon monocyte differentiation.
19935876 2009 Functional cooperation between Stat-1 and ets-1 to optimize icam-1 gene transcription.
19915608 2010 Cooperativity of the MUC1 oncoprotein and STAT1 pathway in poor prognosis human breast cancer.
19915063 2009 Prostacyclin inhibits IFN-gamma-stimulated cytokine expression by reduced recruitment of CBP/p300 to STAT1 in a SOCS-1-independent manner.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19891767 2009 STAT1-dependent expression of energy metabolic pathways links tumour growth and radioresistance to the Warburg effect.
19857525 2010 Inhibition of STAT1 methylation is involved in the resistance of hepatitis B virus to Interferon alpha.
19802007 2010 Cytokine expression and signaling in drug-induced cellular senescence.
19801665 2009 Procaspase 8 and Bax are up-regulated by distinct pathways in Streptococcal pyrogenic exotoxin B-induced apoptosis.
19781967 2009 Molecular dynamics simulations of the conformational changes in signal transducers and activators of transcription, Stat1 and Stat3.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19691533 2009 pSTAT1, pSTAT3, and T-bet as markers of disease activity in chronic inflammatory demyelinating polyradiculoneuropathy.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19667270 2009 Targeting signal transducer and activator of transcription signaling pathway in leukemias.
19656875 2009 Venezuelan equine encephalitis virus disrupts STAT1 signaling by distinct mechanisms independent of host shutoff.
19652026 2009 Role of STAT1, NF-kappaB, and C/EBPbeta in the macrophage transcriptional regulation of hepcidin by mycobacterial infection and IFN-gamma.
19646959 2009 STAT1 represses hypoxia-inducible factor-1-mediated transcription.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19622834 2009 Intracellular delivery of a cell-penetrating SOCS1 that targets IFN-gamma signaling.
19604093 2009 Genetic polymorphisms, their allele combinations and IFN-beta treatment response in Irish multiple sclerosis patients.
19596857 2009 Mechanisms of resistance to interferon-gamma-mediated cell growth arrest in human oral squamous carcinoma cells.
19594299 2010 Gene expression profiling in monocytes and SNP association suggest the importance of the STAT1 gene for osteoporosis in both Chinese and Caucasians.
19582813 2009 Interleukin-27 displays interferon-gamma-like functions in human hepatoma cells and hepatocytes.
19574556 2009 Interferon-gamma induces prolyl hydroxylase (PHD)3 through a STAT1-dependent mechanism in human endothelial cells.
19561067 2009 Palmitoylation of interferon-alpha (IFN-alpha) receptor subunit IFNAR1 is required for the activation of Stat1 and Stat2 by IFN-alpha.
19553685 2009 Inactivation of mammalian target of rapamycin increases STAT1 nuclear content and transcriptional activity in alpha4- and protein phosphatase 2A-dependent fashion.
19515782 2009 Nipah virus sequesters inactive STAT1 in the nucleus via a P gene-encoded mechanism.
19508864 2009 Constitutive JAK2/STAT1 activation regulates endogenous BACE1 expression in neurons.
19502801 2009 Stat1 is an inhibitor of Ras-MAPK signaling and Rho small GTPase expression with implications in the transcriptional signature of Ras transformed cells.
19478064 2009 Unphosphorylated STAT1 prolongs the expression of interferon-induced immune regulatory genes.
19464956 2009 Hypothesis: sarcoidosis is a STAT1-mediated disease.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19439556 2009 STAT1 contributes to the maintenance of the latency III viral programme observed in Epstein-Barr virus-transformed B cells and their recognition by CD8+ T cells.
19437244 2009 Radioresistance of Stat1 over-expressing tumour cells is associated with suppressed apoptotic response to cytotoxic agents and increased IL6-IL8 signalling.
19436109 2009 A partial form of recessive STAT1 deficiency in humans.
19434718 2009 Variants in interferon-alpha pathway genes and response to pegylated interferon-Alpha2a plus ribavirin for treatment of chronic hepatitis C virus infection in the hepatitis C antiviral long-term treatment against cirrhosis trial.
19424608 2009 Absence of STAT1 disturbs the anticancer effect induced by STAT3 inhibition in head and neck carcinoma cell lines.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19404407 2009 Type I interferons and interferon regulatory factors regulate TNF-related apoptosis-inducing ligand (TRAIL) in HIV-1-infected macrophages.
19393742 2009 Reciprocal regulation of the bile acid-activated receptor FXR and the interferon-gamma-STAT-1 pathway in macrophages.
19380416 2009 The tight junction protein ZO-2 mediates proliferation of vascular smooth muscle cells via regulation of Stat1.
19351818 2009 IRF-9/STAT2 [corrected] functional interaction drives retinoic acid-induced gene G expression independently of STAT1.
19342095 2009 Cystatin B associates with signal transducer and activator of transcription 1 in monocyte-derived and placental macrophages.
19333953 2009 High-density genotyping of STAT4 reveals multiple haplotypic associations with systemic lupus erythematosus in different racial groups.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19231233 2009 Cytokine production through PKC/p38 signaling pathways, not through JAK/STAT1 pathway, in mast cells stimulated with IFNgamma.
19223260 2009 An in vivo genome wide gene expression study of circulating monocytes suggested GBP1, STAT1 and CXCL10 as novel risk genes for the differentiation of peak bone mass.
19211553 2009 Dimeric quaternary structure of the prototypical dual specificity phosphatase VH1.
19171783 2009 A phosphorylation-acetylation switch regulates STAT1 signaling.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19136629 2009 PRMT1-mediated arginine methylation of PIAS1 regulates STAT1 signaling.
19124747 2009 Regulation of the foxp3 gene by the Th1 cytokines: the role of IL-27-induced STAT1.
19100922 2009 Radiosensitization by inhibiting STAT1 in renal cell carcinoma.
19088846 2008 Analysis of STAT1 activation by six FGFR3 mutants associated with skeletal dysplasia undermines dominant role of STAT1 in FGFR3 signaling in cartilage.
19074829 2008 DNA methylation represses IFN-gamma-induced and signal transducer and activator of transcription 1-mediated IFN regulatory factor 8 activation in colon carcinoma cells.
19046253 2009 Molecular mechanisms of IL-18BP regulation in DLD-1 cells: pivotal direct action of the STAT1/GAS axis on the promoter level.
19041714 2009 The IFNgamma-induced STAT1-CBP/P300 association, required for a normal response to the cytokine, is disrupted in Brucella-infected macrophages.
19017763 2009 Enhanced expression of Janus kinase-signal transducer and activator of transcription pathway members in human diabetic nephropathy.
19012493 2009 Common variants in immune and DNA repair genes and risk for human papillomavirus persistence and progression to cervical cancer.
19007958 2009 Inhibition of IFN-alpha/beta signaling by two discrete peptides within measles virus V protein that specifically bind STAT1 and STAT2.
18989459 2008 Influenza A virus inhibits type I IFN signaling via NF-kappaB-dependent induction of SOCS-3 expression.
18950845 2009 Evaluating new candidate SNPs as low penetrance risk factors in sporadic breast cancer: a two-stage Spanish case-control study.
18832710 2008 Inhibition of IFN-gamma-induced STAT1 tyrosine phosphorylation by human CMV is mediated by SHP2.
18818378 2008 Hyaluronan-mediated leukocyte adhesion and dextran sulfate sodium-induced colitis are attenuated in the absence of signal transducer and activator of transcription 1.
18803832 2008 Role of STAT4 polymorphisms in systemic lupus erythematosus in a Japanese population: a case-control association study of the STAT1-STAT4 region.
18789440 2009 IFN-gamma down-regulates ABCA1 expression by inhibiting LXRalpha in a JAK/STAT signaling pathway-dependent manner.
18787531 2009 Iron chelators and hypoxia mimetics inhibit IFNgamma-mediated Jak-STAT signaling.
18787082 2008 Genome-wide relationship between histone H3 lysine 4 mono- and tri-methylation and transcription factor binding.
18775329 2008 Nuclear beta-arrestin1 functions as a scaffold for the dephosphorylation of STAT1 and moderates the antiviral activity of IFN-gamma.
18771758 2008 Interferon-sensitive response element (ISRE) is mainly responsible for IFN-alpha-induced upregulation of programmed death-1 (PD-1) in macrophages.
18721752 2008 System-wide investigation of ErbB4 reveals 19 sites of Tyr phosphorylation that are unusually selective in their recruitment properties.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18633131 2008 Host immune gene polymorphisms in combination with clinical and demographic factors predict late survival in diffuse large B-cell lymphoma patients in the pre-rituximab era.
18591661 2008 Tyrosine phosphorylation regulates the partitioning of STAT1 between different dimer conformations.
18586252 2009 High glucose and interferon gamma synergistically stimulate MMP-1 expression in U937 macrophages by increasing transcription factor STAT1 activity.
18579584 2008 STAT-1- and IRF-3-dependent pathways are not essential for repression of ICP0-null mutant herpes simplex virus type 1 in human fibroblasts.
18566411 2008 Activation of the JAK/STAT-1 signaling pathway by IFN-gamma can down-regulate functional expression of the MHC class I-related neonatal Fc receptor for IgG.
18500930 2008 Selective killing of Mycobacterium avium-infected macrophages by inhibition of phosphorylated signal transducer and activator of transcription type 1.
18483262 2008 Constitutive activation of signal transducers and activators of transcription predicts vorinostat resistance in cutaneous T-cell lymphoma.
18463151 2008 Epstein-Barr virus SM protein functions as an alternative splicing factor.
18424756 2008 IL-27 activates human monocytes via STAT1 and suppresses IL-10 production but the inflammatory functions of IL-27 are abrogated by TLRs and p38.
18401423 2008 Tie2-R849W mutant in venous malformations chronically activates a functional STAT1 to modulate gene expression.
18381204 2008 KAP1 regulates type I interferon/STAT1-mediated IRF-1 gene expression.
18370868 2008 IFN-beta-mediated inhibition of IL-8 expression requires the ISGF3 components Stat1, Stat2, and IRF-9.
18348986 2008 The proinflammatory cytokine, interleukin-6, up-regulates calcium-sensing receptor gene transcription via Stat1/3 and Sp1/3.
18338947 2008 Multiple sclerosis and hepatitis C virus infection are associated with single nucleotide polymorphisms in interferon pathway genes.
18305569 2008 STAT3 as a biomarker of progression in atypical nevi of patients with melanoma: dose-response effects of systemic IFNalpha therapy.
18305014 2008 Cysteinyl leukotriene-1 receptor activation in a human bronchial epithelial cell line leads to signal transducer and activator of transcription 1-mediated eosinophil adhesion.
18280748 2008 Interleukin-15 improves cytotoxicity of natural killer cells via up-regulating NKG2D and cytotoxic effector molecule expression as well as STAT1 and ERK1/2 phosphorylation.
18225539 STAT-1 expression in human glioblastoma and peritumoral tissue.
18218993 2008 Human metapneumovirus inhibits IFN-alpha signaling through inhibition of STAT1 phosphorylation.
18062835 2008 Novel insight in the association between salmonellosis or campylobacteriosis and chronic illness, and the role of host genetics in susceptibility to these diseases.
18035482 2008 Regulation of XAF1 expression in human colon cancer cell by interferon beta: activation by the transcription regulator STAT1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18003888 2008 STAT1 signaling modulates HIV-1-induced inflammatory responses and leukocyte transmigration across the blood-brain barrier.
17986321 2007 S100A7 (Psoriasin), highly expressed in ductal carcinoma in situ (DCIS), is regulated by IFN-gamma in mammary epithelial cells.
17983380 2007 STAT1 gene variations, IgE regulation and atopy.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17938255 2008 The opposite effects of IL-15 and IL-21 on CLL B cells correlate with differential activation of the JAK/STAT and ERK1/2 pathways.
17933493 2008 Sequential activation of protein kinase C delta and JNK is required for interferon-alpha-induced expression of IFIT4.
17928350 2007 Ebola virus VP24 proteins inhibit the interaction of NPI-1 subfamily karyopherin alpha proteins with activated STAT1.
17923090 2007 Acetylation-dependent signal transduction for type I interferon receptor.
17918184 2008 EGFR induces expression of IRF-1 via STAT1 and STAT3 activation leading to growth arrest of human cancer cells.
17909067 2007 Association study of 69 genes in the ret pathway identifies low-penetrance loci in sporadic medullary thyroid carcinoma.
17897103 2008 MAPK-induced Ser727 phosphorylation promotes SUMOylation of STAT1.
17878351 2007 IFN-epsilon mediates TNF-alpha-induced STAT1 phosphorylation and induction of retinoic acid-inducible gene-I in human cervical cancer cells.
17804871 Diallyl disulfide induced signal transducer and activator of transcription 1 expression in human colon cancer colo 205 cells using differential display RT-PCR.
17726060 2007 P-STAT1 mediates higher-order chromatin remodelling of the human MHC in response to IFNgamma.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17686504 2007 Measles virus V protein blocks Jak1-mediated phosphorylation of STAT1 to escape IFN-alpha/beta signaling.
17680769 2007 STAT1 gene expression in cervical carcinomas.
17640695 2007 Catalytic turnover of STAT1 allows PIV5 to dismantle the interferon-induced anti-viral state of cells.
17617740 2007 Interferon-alpha induces TRAIL expression and cell death via an IRF-1-dependent mechanism in human bladder cancer cells.
17596301 2007 Severe acute respiratory syndrome coronavirus ORF6 antagonizes STAT1 function by sequestering nuclear import factors on the rough endoplasmic reticulum/Golgi membrane.
17561467 2007 Sustained phosphorylation of mutated FGFR3 is a crucial feature of genetic dwarfism and induces apoptosis in the ATDC5 chondrogenic cell line via PLCgamma-activated STAT1.
17538964 2007 Engulfment of apoptotic cells expressing HCV proteins leads to differential chemokine expression and STAT signaling in human dendritic cells.
17523873 2007 Stat1 required for interferon-inducible but not constitutive responsiveness to extracellular dsRNA.
17490620 2007 Induction of high STAT1 expression in transgenic mice with LQTS and heart failure.
17486072 2007 Epstein-Barr virus-encoded EBNA1 regulates cellular gene transcription and modulates the STAT1 and TGFbeta signaling pathways.
17442890 2007 A Mutation in the SH2 domain of STAT2 prolongs tyrosine phosphorylation of STAT1 and promotes type I IFN-induced apoptosis.
17427945 2007 Diverse effects of Stat1 on the regulation of hsp90alpha gene under heat shock.
17386941 2007 Phosphorylation of IRF8 in a pre-associated complex with Spi-1/PU.1 and non-phosphorylated Stat1 is critical for LPS induction of the IL1B gene.
17371985 2007 TGF-beta suppresses IFN-gamma-STAT1-dependent gene transcription by enhancing STAT1-PIAS1 interactions in epithelia but not monocytes/macrophages.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17351669 2007 STAT activation and differential complex formation dictate selectivity of interferon responses.
17346710 2007 STAT1 regulates p73-mediated Bax gene expression.
17311277 2007 Fibroblast growth factor receptor-induced phosphorylation of STAT1 at the Golgi apparatus without translocation to the nucleus.
17287281 2007 The nucleocytoplasmic rabies virus P protein counteracts interferon signaling by inhibiting both nuclear accumulation and DNA binding of STAT1.
17275127 2007 HCV NS5A inhibits interferon-alpha signaling through suppression of STAT1 phosphorylation in hepatocyte-derived cell lines.
17266440 2007 Jak inhibition, but not Stat1 knockdown, blocks the synergistic effect of IFN-gamma on Fas-induced apoptosis of A549 human non-small cell lung cancer cells.
17237409 2007 Dampening of IFN-gamma-inducible gene expression in human choriocarcinoma cells is due to phosphatase-mediated inhibition of the JAK/STAT-1 pathway.
17227821 2007 Immune complexes suppress IFN-gamma signaling by activation of the FcgammaRI pathway.
17196131 2006 [Effect of HCV NS5A on STAT1 phosphorylation and nuclear translocation induced by IFN alpha-2b].
17182865 2006 Dephosphorylation of phosphotyrosine on STAT1 dimers requires extensive spatial reorientation of the monomers facilitated by the N-terminal domain.
17145596 2006 The presence of STAT1-positive tumor-associated macrophages and their relation to outcome in patients with follicular lymphoma.
17075845 2006 Overexpression of phosphorylated STAT-1alpha in the labial salivary glands of patients with Sjögren's syndrome.
17030574 2006 Up-regulation of gamma interferon receptor expression due to Chlamydia-toll-like receptor interaction does not enhance signal transducer and activator of transcription 1 signaling.
16978698 2007 Respiratory syncytial virus inhibits interferon-alpha-inducible signaling in macrophage-like U937 cells.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16951379 2006 Opposing actions of Stat1 and Stat6 on IL-13-induced up-regulation of early growth response-1 and platelet-derived growth factor ligands in pulmonary fibroblasts.
16940534 2006 Hepatitis C virus core protein blocks interferon signaling by interaction with the STAT1 SH2 domain.
16935931 2006 Free radical scavenging inhibits STAT phosphorylation following in vivo ischemia/reperfusion injury.
16934001 2006 Novel STAT1 alleles in otherwise healthy patients with mycobacterial disease.
16918696 2006 Inhibition of monocytic differentiation by phosphorylation-deficient Stat1 is associated with impaired expression of Stat2, ICSBP/IRF8 and C/EBPepsilon.
16904741 Soluble factors from LPS- and PHA-activated PBMC induce MAPK, Stat1 and Stat3 phosphorylation in primary cultures of human term placental trophoblasts: implications for infection and prematurity.
16897667 2006 Signal transducer and activator of transcription factor 1 mediates apoptosis induced by hepatitis C virus and HIV envelope proteins in hepatocytes.
16878149 2007 Hypoxic repression of STAT1 and its downstream genes by a pVHL/HIF-1 target DEC1/STRA13.
16799645 2006 Serine-phosphorylated STAT1 is a prosurvival factor in Wilms' tumor pathogenesis.
16773129 2006 The downstream modulator of interferon-gamma, STAT1 is not genetically associated to the Dutch coeliac disease population.
16628196 2006 SOCS1-negative feedback of STAT1 activation is a key pathway in the dsRNA-induced innate immune response of human keratinocytes.
16585190 2006 Signal transducer and activator of transcription 1 activation in endothelial cells is a negative regulator of angiogenesis.
16574066 2006 Transcriptional up-regulation of restin by all-trans retinoic acid through STAT1 in cancer cell differentiation process.
16572323 2006 Antiproliferative effect of indomethacin on CML cells is related to the suppression of STATs/Bcl-XL signal pathway.
16571725 2006 Role of STAT3 in type I interferon responses. Negative regulation of STAT1-dependent inflammatory gene activation.
16531398 2006 Tid1 isoforms are mitochondrial DnaJ-like chaperones with unique carboxyl termini that determine cytosolic fate.
16512786 2006 Intracellular HIV-1 Tat protein represses constitutive LMP2 transcription increasing proteasome activity by interfering with the binding of IRF-1 to STAT1.
16511123 2005 Crystallization and X-ray crystallographic analysis of human STAT1.
16501077 2006 Inhibition of interferon signaling by rabies virus phosphoprotein P: activation-dependent binding of STAT1 and STAT2.
16481475 2006 Acetylation of Stat1 modulates NF-kappaB activity.
16467883 2006 Modulation of the activation of Stat1 by the interferon-gamma receptor complex.
16388135 2005 The amino-terminal domain of human signal transducers and activators of transcription 1: overexpression, purification and characterization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16318585 2005 Differential effects of TNF-alpha and IFN-gamma on gene transcription mediated by NF-kappaB-Stat1 interactions.
16306601 2005 Respiratory syncytial virus-inducible BCL-3 expression antagonizes the STAT/IRF and NF-kappaB signaling pathways by inducing histone deacetylase 1 recruitment to the interleukin-8 promoter.
16273093 2006 A quantitative protein interaction network for the ErbB receptors using protein microarrays.
16260419 2005 Interferon-alpha-induced expression of phospholipid scramblase 1 through STAT1 requires the sequential activation of protein kinase Cdelta and JNK.
16257975 2005 The conserved Leu-724 residue is required for both serine phosphorylation and co-activator recruitment for Stat1-mediated transcription activation in response to interferon-gamma.
16254375 2005 Rabies virus P protein interacts with STAT1 and inhibits interferon signal transduction pathways.
16236267 2005 Proteomic analysis of SUMO4 substrates in HEK293 cells under serum starvation-induced stress.
16223733 2005 Human serum from patients with septic shock activates transcription factors STAT1, IRF1, and NF-kappaB and induces apoptosis in human cardiac myocytes.
16195225 2005 Nuclear export determines the cytokine sensitivity of STAT transcription factors.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16148142 2005 Critical roles for both STAT1-dependent and STAT1-independent pathways in the control of primary dengue virus infection in mice.
16148108 2005 IFN-gamma-primed macrophages exhibit increased CCR2-dependent migration and altered IFN-gamma responses mediated by Stat1.
16139798 2005 Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.
16077199 2005 Position of STAT-1 alpha in cycloheximide-dependent apoptosis triggered by TNF-alpha in human colorectal COLO 205 cancer cell line; role of polyphenolic compounds.
15998520 2006 Changes in aortic endothelial gene expressions and relaxation responses following chronic short-term insulin treatment in diabetic rats.
15996661 2005 STAT1 and Nmi are downstream targets of Ets-1 transcription factor in MCF-7 human breast cancer cell.
15979846 2006 Prostacyclin receptor induces STAT1 and STAT3 phosphorylations in human erythroleukemia cells: a mechanism requiring PTX-insensitive G proteins, ERK and JNK.
15919942 2005 Inhibition of STAT 1 phosphorylation by human parainfluenza virus type 3 C protein.
15825084 2005 Hepatitis C virus expression suppresses interferon signaling by degrading STAT1.
15824515 2005 STAT1-independent down-regulation of interferon-gamma-induced class II transactivator and HLA-DR expression by transforming growth factor beta-1 in human glomerular endothelial cells.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15795279 2005 Latent membrane protein 1 regulates STAT1 through NF-kappaB-dependent interferon secretion in Epstein-Barr virus-immortalized B cells.
15780933 2005 Structural bases of unphosphorylated STAT1 association and receptor binding.
15778351 2005 IFN regulatory factor-2 cooperates with STAT1 to regulate transporter associated with antigen processing-1 promoter activity.
15650219 2005 Inhibition of interferon signaling by the New York 99 strain and Kunjin subtype of West Nile virus involves blockage of STAT1 and STAT2 activation by nonstructural proteins.
15604419 2005 Cytokine-stimulated GTP cyclohydrolase I expression in endothelial cells requires coordinated activation of nuclear factor-kappaB and Stat1/Stat3.
15527154 2004 Functional and genetic assessment of IFN-gamma receptor in patients with clinical tuberculosis.
15526160 2004 Signal transduction via the stem cell factor receptor/c-Kit.
15494521 2004 Rac1 contributes to maximal activation of STAT1 and STAT3 in IFN-gamma-stimulated rat astrocytes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15467722 2004 Amplification of IFN-alpha-induced STAT1 activation and inflammatory function by Syk and ITAM-containing adaptors.
15322115 2004 Protein kinase Cdelta regulates apoptosis via activation of STAT1.
15284024 2004 EGFR-induced cell migration is mediated predominantly by the JAK-STAT pathway in primary esophageal keratinocytes.
15280488 2004 A short peptide at the amino terminus of the Sendai virus C protein acts as an independent element that induces STAT1 instability.
15221897 2004 Expression of hepatitis C virus core protein inhibits interferon-induced nuclear import of STATs.
15217838 2004 Differential roles of STAT1alpha and STAT1beta in fludarabine-induced cell cycle arrest and apoptosis in human B cells.
15213094 2005 A novel role for STAT1 in regulating murine erythropoiesis: deletion of STAT1 results in overall reduction of erythroid progenitors and alters their distribution.
15210729 2004 Nucleocytoplasmic shuttling by nucleoporins Nup153 and Nup214 and CRM1-dependent nuclear export control the subcellular distribution of latent Stat1.
15165826 2004 Multiple signal transducers and activators of transcription are induced by EBV LMP-1.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15140960 2004 Nipah virus V and W proteins have a common STAT1-binding domain yet inhibit STAT1 activation from the cytoplasmic and nuclear compartments, respectively.
15123634 2004 Requirement of histone deacetylase activity for signaling by STAT1.
15055356 2004 Signal transducer and activator of transcription-1 (STAT1), but not STAT5b, regulates IGF-I receptor gene expression in an osteosarcoma cell line.
15010467 2004 A single residue modulates tyrosine dephosphorylation, oligomerization, and nuclear accumulation of stat transcription factors.
14976049 2004 SOCS1 and SHP1 hypermethylation in multiple myeloma: implications for epigenetic activation of the Jak/STAT pathway.
14963018 2004 Evidence of STAT1 phosphorylation modulated by MAPKs, MEK1 and MSK1.
14755057 2004 STAT1 is overexpressed in tumors selected for radioresistance and confers protection from radiation in transduced sensitive cells.
14751560 2004 Overexpression of FGFR3, Stat1, Stat5 and p21Cip1 correlates with phenotypic severity and defective chondrocyte differentiation in FGFR3-related chondrodysplasias.
14746803 2003 Mitochondrial adenine nucleotide translocator 3 is regulated by IL-4 and IFN-gamma via STAT-dependent pathways.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14690454 2004 Interferon-gamma inhibits interferon-alpha signalling in hepatic cells: evidence for the involvement of STAT1 induction and hyperexpression of STAT1 in chronic hepatitis C.
14688135 2004 Helicobacter pylori disrupts STAT1-mediated gamma interferon-induced signal transduction in epithelial cells.
14674010 2003 Chemokine receptor expression and in vivo signaling pathways in the joints of rats with adjuvant-induced arthritis.
14657353 2003 IL-27 regulates IL-12 responsiveness of naive CD4+ T cells through Stat1-dependent and -independent mechanisms.
14656722 2004 Progressive dysregulation of transcription factors NF-kappa B and STAT1 in prostate cancer cells causes proangiogenic production of CXC chemokines.
14654702 2003 Transcription factor ZBP-89 is required for STAT1 constitutive expression.
14654078 2004 Oral fludarabine has significant activity in patients with previously untreated chronic lymphocytic leukemia, and leads to increased STAT1 levels in vivo.
14623896 2004 STAT1-induced apoptosis is mediated by caspases 2, 3, and 7.
14600148 2004 Cells previously desensitized to type 1 interferons display different mechanisms of activation of stat-dependent gene expression from naïve cells.
14599788 2003 The C-terminal half-fragment of the Sendai virus C protein prevents the gamma-activated factor from binding to a gamma-activated sequence site.
14557668 2003 Hendra virus V protein inhibits interferon signaling by preventing STAT1 and STAT2 nuclear accumulation.
14500749 2003 Role for nuclear factor-kappaB and signal transducer and activator of transcription 1/interferon regulatory factor-1 in cytokine-induced endothelin-1 release in human vascular smooth muscle cells.
12967644 2003 IFNalpha regulates NK cell cytotoxicity through STAT1 pathway.
12963127 2003 Differentiation-dependent expression of signal transducers and activators of transcription (STATs) might modify responses to growth factors in the cancers of the head and neck.
12948935 2003 Statin-mediated correction of STAT1 signaling and inducible nitric oxide synthase expression in cystic fibrosis epithelial cells.
12923054 2003 DNA binding controls inactivation and nuclear accumulation of the transcription factor Stat1.
12917439 2003 Suppression of thermotolerance in mumps virus-infected cells is caused by lack of HSP27 induction contributed by STAT-1.
12867595 2003 The cell death regulator GRIM-19 is an inhibitor of signal transducer and activator of transcription 3.
12856330 2003 IRAK-dependent phosphorylation of Stat1 on serine 727 in response to interleukin-1 and effects on gene expression.
12855578 2003 PIAS proteins promote SUMO-1 conjugation to STAT1.
12855573 2003 STAT1 mediates differentiation of chronic lymphocytic leukemia cells in response to Bryostatin 1.
12846741 2003 STAT proteins mediate angiotensin II-induced production of TIMP-1 in human proximal tubular epithelial cells.
12832402 2003 STATs dimerize in the absence of phosphorylation.
12817007 2003 Activation of protein kinase C delta by IFN-gamma.
12807916 2003 Stimulation of signal transducer and activator of transcription-1 (STAT1)-dependent gene transcription by lipopolysaccharide and interferon-gamma is regulated by mammalian target of rapamycin.
12804771 2003 Measles virus V protein blocks interferon (IFN)-alpha/beta but not IFN-gamma signaling by inhibiting STAT1 and STAT2 phosphorylation.
12788789 2003 STAT-1 and c-Fos interaction in nitric oxide synthase-2 gene activation.
12777975 2003 The JAK/STAT pathway is not sufficient to sustain the antiproliferative response in an interferon-resistant human melanoma cell line.
12764129 2003 SUMO modification of STAT1 and its role in PIAS-mediated inhibition of gene activation.
12759242 2003 Constitutive activation of the signal transducer and activator of transcription pathway in celiac disease lesions.
12748293 2003 Interleukin-13 induction of 15-lipoxygenase gene expression requires p38 mitogen-activated protein kinase-mediated serine 727 phosphorylation of Stat1 and Stat3.
12734330 2003 Cutting edge: role of IL-27/WSX-1 signaling for induction of T-bet through activation of STAT1 during initial Th1 commitment.
12722480 2003 [EGF-induced signal transduction in clonal cells of epidermoid carcinoma A431].
12637327 2003 Ser727/Tyr701-phosphorylated Stat1 is required for the regulation of c-Myc, cyclins, and p27Kip1 associated with ATRA-induced G0/G1 arrest of U-937 cells.
12634403 2003 Epstein-Barr virus regulates STAT1 through latent membrane protein 1.
12629155 2003 Human immunodeficiency virus type 1 (HIV-1) induces activation of multiple STATs in CD4+ cells of lymphocyte or monocyte/macrophage lineages.
12610144 2003 The Epstein-Barr virus SM protein induces STAT1 and interferon-stimulated gene expression.
12590259 2003 Impaired response to interferon-alpha/beta and lethal viral disease in human STAT1 deficiency.
12551969 2003 The amino-terminal extensions of the longer Sendai virus C proteins modulate pY701-Stat1 and bulk Stat1 levels independently of interferon signaling.
12539042 2003 HIV-1 Tat reprograms immature dendritic cells to express chemoattractants for activated T cells and macrophages.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459177 2002 Nuclear phosphatases and the proteasome in suppression of STAT1 activity in hepatocytes.
12447867 2002 Genetic polymorphisms in interferon pathway and response to interferon treatment in hepatitis B patients: A pilot study.
12426389 2002 A novel nuclear zinc finger protein EZI enhances nuclear retention and transactivation of STAT3.
12388709 2002 Nipah virus V protein evades alpha and gamma interferons by preventing STAT1 and STAT2 activation and nuclear accumulation.
12356736 2002 Transcription factor Sp3 is silenced through SUMO modification by PIAS1.
12270932 2002 SHP-2 is a dual-specificity phosphatase involved in Stat1 dephosphorylation at both tyrosine and serine residues in nuclei.
12232802 2002 The C-terminal activation domain of the STAT-1 transcription factor is necessary and sufficient for stress-induced apoptosis.
12232043 2002 p38 MAPK enhances STAT1-dependent transcription independently of Ser-727 phosphorylation.
12223098 2003 The TATA-containing core promoter of the type II collagen gene (COL2A1) is the target of interferon-gamma-mediated inhibition in human chondrocytes: requirement for Stat1 alpha, Jak1 and Jak2.
12191570 2002 Human B-cell lymphoma cell lines are highly sensitive to apoptosis induced by all-trans retinoic acid and interferon-gamma.
12171910 2002 Arginine methylation of STAT1 regulates its dephosphorylation by T cell protein tyrosine phosphatase.
12167251 The roles of inflammation, STAT transcription factors, and nerve growth factor in viral reactivation and herpes keratitis.
12165521 2002 Lipid microdomains are required sites for the selective endocytosis and nuclear translocation of IFN-gamma, its receptor chain IFN-gamma receptor-1, and the phosphorylation and nuclear translocation of STAT1alpha.
12161037 2002 Low expression of interferon-stimulated genes in active multiple sclerosis is linked to subnormal phosphorylation of STAT1.
12138178 2002 Identification of a nuclear Stat1 protein tyrosine phosphatase.
12130529 2002 Distinct functions for signal transducer and activator of transcription 1 and PU.1 in transcriptional activation of Fc gamma receptor I promoter.
12108949 2002 The role of STATs in apoptosis.
12070153 2002 Identification of both positive and negative domains within the epidermal growth factor receptor COOH-terminal region for signal transducer and activator of transcription (STAT) activation.
12048190 2002 Arginine/lysine-rich nuclear localization signals mediate interactions between dimeric STATs and importin alpha 5.
12039028 2002 Signaling through the JAK/STAT pathway, recent advances and future challenges.
11981818 2002 Block of Stat-1 activation in macrophages phagocytosing bacteria causes reduced transcription of CIITA and consequent impaired antigen presentation.
11972023 2002 Requirement of Ca2+ and CaMKII for Stat1 Ser-727 phosphorylation in response to IFN-gamma.
11932384 2002 Selective STAT protein degradation induced by paramyxoviruses requires both STAT1 and STAT2 but is independent of alpha/beta interferon signal transduction.
11927559 2002 Regulated nuclear import of the STAT1 transcription factor by direct binding of importin-alpha.
11909970 2002 Stat1-vitamin D receptor interactions antagonize 1,25-dihydroxyvitamin D transcriptional activity and enhance stat1-mediated transcription.
11909852 2002 Isolation and characterization of a human STAT1 gene regulatory element. Inducibility by interferon (IFN) types I and II and role of IFN regulatory factor-1.
11886859 2002 Identification of STAT-1 as a molecular target of IGFBP-3 in the process of chondrogenesis.
11843291 2002 Constitutive activation of Stat1 and Stat3 in primary erythroleukemia cells.
11839738 2002 Protein kinase C-delta (PKC-delta ) is activated by type I interferons and mediates phosphorylation of Stat1 on serine 727.
11815625 2002 Cytokine signaling: STATS in plasma membrane rafts.
11804954 2002 Roles of Stat1, Stat2, and interferon regulatory factor-9 (IRF-9) in interferon tau regulation of IRF-1.
11777927 2002 Activation of signal transducer and activator of transcription 1 (STAT1) is not sufficient for the induction of STAT1-dependent genes in endothelial cells. Comparison of interferon-gamma and oncostatin M.
11722592 2001 Constitutive activation of STAT transcription factors in acute myelogenous leukemia.
11452125 2001 Impairment of mycobacterial but not viral immunity by a germline human STAT1 mutation.
11442634 2001 Sendai virus C protein physically associates with Stat1.
11418623 2001 Cutting edge: the common gamma-chain is an indispensable subunit of the IL-21 receptor complex.
11301323 2001 The WD motif-containing protein receptor for activated protein kinase C (RACK1) is required for recruitment and activation of signal transducer and activator of transcription 1 through the type I interferon receptor.
11294897 2001 Identification of tyrosine residues in constitutively activated fibroblast growth factor receptor 3 involved in mitogenesis, Stat activation, and phosphatidylinositol 3-kinase activation.
11278865 2001 Enhanced antiviral and antiproliferative properties of a STAT1 mutant unable to interact with the protein kinase PKR.
11278462 2001 Focal adhesion kinase activates Stat1 in integrin-mediated cell migration and adhesion.
11257227 2001 Arginine methylation of STAT1 modulates IFNalpha/beta-induced transcription.
11248027 2001 Identification of two residues in MCM5 critical for the assembly of MCM complexes and Stat1-mediated transcription activation in response to IFN-gamma.
11238845 2001 Vaccinia virus blocks gamma interferon signal transduction: viral VH1 phosphatase reverses Stat1 activation.
11226159 2001 Specificity of signaling by STAT1 depends on SH2 and C-terminal domains that regulate Ser727 phosphorylation, differentially affecting specific target gene expression.
11152457 2001 The angiotensin II-dependent nuclear translocation of Stat1 is mediated by the Jak2 protein motif 231YRFRR.
10982844 2000 Regulation of STAT1 nuclear export by Jak1.
10961983 2000 Vascular endothelial growth factor activates STAT proteins in aortic endothelial cells.
10954736 2000 A Stat3-interacting protein (StIP1) regulates cytokine signal transduction.
10918587 2000 Transformation and Stat activation by derivatives of FGFR1, FGFR3, and FGFR4.
10851062 2000 Serine phosphorylation of STATs.
10851046 2000 STATs in oncogenesis.
10848598 2000 The Fanconi anemia protein FANCC binds to and facilitates the activation of STAT1 by gamma interferon and hematopoietic growth factors.
10848577 2000 Stat1 as a component of tumor necrosis factor alpha receptor 1-TRADD signaling complex to inhibit NF-kappaB activation.
10805787 2000 Distinct roles of the NH2- and COOH-terminal domains of the protein inhibitor of activated signal transducer and activator of transcription (STAT) 1 (PIAS1) in cytokine-induced PIAS1-Stat1 interaction.
10792030 2000 Collaboration of signal transducer and activator of transcription 1 (STAT1) and BRCA1 in differential regulation of IFN-gamma target genes.
10764778 2000 Adenovirus E1A down-regulates LMP2 transcription by interfering with the binding of stat1 to IRF1.
10702714 1999 Viral inhibition of interferon signal transduction.
10692450 2000 Thrombin inhibits tumor cell growth in association with up-regulation of p21(waf/cip1) and caspases via a p53-independent, STAT-1-dependent pathway.
10652206 2000 Linkage between alpha(1) adrenergic receptor and the Jak/STAT signaling pathway in vascular smooth muscle cells.
10602027 2000 Association of STAT1, STAT3 and STAT5 proteins with the IL-2 receptor involves different subdomains of the IL-2 receptor beta chain.
10506573 1999 The chemokine SDF-1alpha triggers CXCR4 receptor dimerization and activates the JAK/STAT pathway.
10490649 1999 Interacting regions in Stat3 and c-Jun that participate in cooperative transcriptional activation.
10446176 1999 Urokinase induces activation and formation of Stat4 and Stat1-Stat2 complexes in human vascular smooth muscle cells.
10358045 1999 STAT protein recruitment and activation in c-Kit deletion mutants.
10067896 1999 Inhibition of transforming growth factor-beta/SMAD signalling by the interferon-gamma/STAT pathway.
9989503 1999 Functional association of Nmi with Stat5 and Stat1 in IL-2- and IFNgamma-mediated signaling.
9925928 1998 Assignment1 of STAT1 to human chromosome 2q32 by FISH and radiation hybrids.
9881977 1998 Direct suppression of Stat1 function during adenoviral infection.
9880553 1999 Signal transducer and activator of transcription-1 and heat shock factor-1 interact and activate the transcription of the Hsp-70 and Hsp-90beta gene promoters.
9843502 1998 Ser727-dependent recruitment of MCM5 by Stat1alpha in IFN-gamma-induced transcriptional activation.
9804857 1998 Angiotensin II-induced tyrosine phosphorylation of signal transducers and activators of transcription 1 is regulated by Janus-activated kinase 2 and Fyn kinases and mitogen-activated protein kinase phosphatase 1.
9724754 1998 Inhibition of Stat1-mediated gene activation by PIAS1.
9630226 1998 Crystal structure of a tyrosine phosphorylated STAT-1 dimer bound to DNA.
9584171 1998 TFII-I enhances activation of the c-fos promoter through interactions with upstream elements.
9484840 1998 Activation of Stat5 by platelet-derived growth factor (PDGF) is dependent on phosphorylation sites in PDGF beta-receptor juxtamembrane and kinase insert domains.
9452495 1998 Midkine induces tumor cell proliferation and binds to a high affinity signaling receptor associated with JAK tyrosine kinases.
9373245 1997 The Bmx tyrosine kinase induces activation of the Stat signaling pathway, which is specifically inhibited by protein kinase Cdelta.
9355737 1997 Stat1 associates with c-kit and is activated in response to stem cell factor.
9344858 1997 c-Src activates both STAT1 and STAT3 in PDGF-stimulated NIH3T3 cells.
9284918 1997 cDNA cloning, expression and chromosome mapping of the human STAT4 gene: both STAT4 and STAT1 genes are mapped to 2q32.2-->q32.3.
9205132 1997 Chromosomal localization of genes encoding CAN/Nup214-interacting proteins--human CRM1 localizes to 2p16, whereas Nup88 localizes to 17p13 and is physically linked to SF2p32.
9135145 1997 Physical association between STAT1 and the interferon-inducible protein kinase PKR and implications for interferon and double-stranded RNA signaling pathways.
9121453 1997 Functional subdomains of STAT2 required for preassociation with the alpha interferon receptor and for signaling.
9069288 1997 Activation of Stat1 by mutant fibroblast growth-factor receptor in thanatophoric dysplasia type II dwarfism.
8986769 1996 Two contact regions between Stat1 and CBP/p300 in interferon gamma signaling.
8943351 1996 Interactions between STAT and non-STAT proteins in the interferon-stimulated gene factor 3 transcription complex.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8662591 1996 Differential activation of acute phase response factor/STAT3 and STAT1 via the cytoplasmic domain of the interleukin 6 signal transducer gp130. I. Definition of a novel phosphotyrosine motif mediating STAT1 activation.
8631962 1996 Granulocyte-macrophage colony-stimulating factor stimulates JAK2 signaling pathway and rapidly activates p93fes, STAT1 p91, and STAT3 p92 in polymorphonuclear leukocytes.
8621447 1996 Formation of STAT1-STAT2 heterodimers and their role in the activation of IRF-1 gene transcription by interferon-alpha.
8608597 1996 Targeted disruption of the Stat1 gene in mice reveals unexpected physiologic specificity in the JAK-STAT signaling pathway.
8605877 1996 The SH2 domains of Stat1 and Stat2 mediate multiple interactions in the transduction of IFN-alpha signals.
8549654 1996 PDGF receptor-to-nucleus signaling of p91 (STAT1 alpha) transcription factor in rat smooth muscle cells.
8232552 1993 The protein tyrosine kinase JAK1 complements defects in interferon-alpha/beta and -gamma signal transduction.
8156998 1994 Ligand-induced IFN gamma receptor tyrosine phosphorylation couples the receptor to its signal transduction system (p91).
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7885841 1995 The genomic structure of the STAT genes: multiple exons in coincident sites in Stat1 and Stat2.
7690989 1993 A single phosphotyrosine residue of Stat91 required for gene activation by interferon-gamma.
7657660 1995 Phosphorylation and activation of the DNA binding activity of purified Stat1 by the Janus protein-tyrosine kinases and the epidermal growth factor receptor.
7543024 1995 Maximal activation of transcription by Stat1 and Stat3 requires both tyrosine and serine phosphorylation.
7514165 1994 Interferon-gamma induces tyrosine phosphorylation of interferon-gamma receptor and regulated association of protein tyrosine kinases, Jak1 and Jak2, with its receptor.
7510216 1994 Interferon activation of the transcription factor Stat91 involves dimerization through SH2-phosphotyrosyl peptide interactions.
1638633 1992 A transcription factor with SH2 and SH3 domains is directly activated by an interferon alpha-induced cytoplasmic protein tyrosine kinase(s).
1502203 1992 Proteins of transcription factor ISGF-3: one gene encodes the 91-and 84-kDa ISGF-3 proteins that are activated by interferon alpha.
1496401 1992 Interferon-dependent tyrosine phosphorylation of a latent cytoplasmic transcription factor.