Property Summary

NCBI Gene PubMed Count 13
PubMed Score 14.95
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Synonym

Accession Q9NQZ5 D3DXG9 Q53T44 Q6GU43 Q969M6
Symbols GTT1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (6)

PMID Text
22952907 StarD7 modulates ABCG2 multidrug transporter level, cell migration, proliferation, and biochemical and morphological differentiation marker expression in a human trophoblast cell model.
22063720 StarD7 behaves as a fusogenic protein in model and cell membrane bilayers.
21622533 The SF-1 and beta-catenin pathway convergence on StarD7 expression may have important implications in the phospholipid uptake and transport, contributing to the normal trophoblast development.
20042613 These results suggest that StarD7 facilitates the delivery of phosphatidylcholine to mitochondria in non-vesicular system.
19679347 Beta-catenin and TCF4 activate the human StarD7 gene interacting with its promoter region through Wnt/beta-catenin signalling.
17672918 the apparent occurrence of an unusual TG 3' splice site in intron 1 is discussed

AA Sequence

MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGRLWRRLHGRPG      1 - 70
HASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQR     71 - 140
WEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGS    141 - 210
EVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFD    211 - 280
ENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKAT    281 - 350
SQSSERKNEGSCGPARIEYA                                                      351 - 370
//

Text Mined References (16)

PMID Year Title
25980009 2015 Haploinsufficiency for Stard7 is associated with enhanced allergic responses in lung and skin.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
23247143 2013 Association of genome-wide variation with highly sensitive cardiac troponin-T levels in European Americans and Blacks: a meta-analysis from atherosclerosis risk in communities and cardiovascular health studies.
22952907 2012 StarD7 knockdown modulates ABCG2 expression, cell migration, proliferation, and differentiation of human choriocarcinoma JEG-3 cells.
22063720 2012 StarD7 behaves as a fusogenic protein in model and cell membrane bilayers.
21622533 2011 StarD7 gene expression in trophoblast cells: contribution of SF-1 and Wnt-beta-catenin signaling.
21269460 2011 Initial characterization of the human central proteome.
20042613 2010 StarD7 mediates the intracellular trafficking of phosphatidylcholine to mitochondria.
19679347 2009 Activation of beta-catenin signalling increases StarD7 gene expression in JEG-3 cells.
17672918 2007 Violating the splicing rules: TG dinucleotides function as alternative 3' splice sites in U2-dependent introns.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
15013637 2004 GTT1/StarD7, a novel phosphatidylcholine transfer protein-like highly expressed in gestational trophoblastic tumour: cloning and characterization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.