Property Summary

NCBI Gene PubMed Count 15
PubMed Score 18.35
PubTator Score 12.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

 GWAS Trait (1)

Protein-protein Interaction (4)

Gene RIF (8)

AA Sequence

MLPRRLLAAWLAGTRGGGLLALLANQCRFVTGLRVRRAQQIAQLYGRLYSESSRRVLLGRLWRRLHGRPG      1 - 70
HASALMAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQR     71 - 140
WEMVMDKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGS    141 - 210
EVLHWVTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFD    211 - 280
ENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKAT    281 - 350
SQSSERKNEGSCGPARIEYA                                                      351 - 370
//

Text Mined References (18)

PMID Year Title