Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.12
PubTator Score 7.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -4.300 2.6e-09
osteosarcoma -2.439 1.8e-09
pancreatic ductal adenocarcinoma liver m... -1.185 3.7e-03

Gene RIF (8)

PMID Text
24440759 Studies show the 3 steroidogenic acute regulatory-related lipid transfer (START) domain proteins StarD4, StarD5 and StarD6 have a similar lipid binding pocket specific for sterols (cholesterol in particular), but differing regulation and localization.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19474188 Data support STARD5 functioning in kidney, specifically within proximal tubule cells, and suggest a role in ER-associated cholesterol transport.
16534142 The presence of StarD5 different human liver cells that are related to inflammatory processes provides new clues to its role of in free sterol transport in the cells and in lipid-mediated atherogenesis.
15897605 demonstrated StarD5 protein in liver cytosolic fractions only, suggesting StarD5 as a directional cytosolic sterol carrier
15760897 StarD4 is regulated by sterols via SREBP-2, and StarD5 is activated by ER stress cholesterol metabolism; they serve different functions

AA Sequence

MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP      1 - 70
AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP     71 - 140
LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ    141 - 210
FHE                                                                       211 - 213
//

Text Mined References (20)

PMID Year Title
24440759 2014 The StarD4 subfamily of steroidogenic acute regulatory-related lipid transfer (START) domain proteins: new players in cholesterol metabolism.
23872533 2013 Thermodynamic and solution state NMR characterization of the binding of secondary and conjugated bile acids to STARD5.
21738568 2011 Comparative structural analysis of lipid binding START domains.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19474188 2009 Steroidogenic acute regulatory-related lipid transfer domain protein 5 localization and regulation in renal tubules.
18403318 2008 Intracellular cholesterol transporter StarD4 binds free cholesterol and increases cholesteryl ester formation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16534142 2006 Localization of StarD5 cholesterol binding protein.
15897605 2005 Human StarD5, a cytosolic StAR-related lipid binding protein.
15760897 2005 Differential gene regulation of StarD4 and StarD5 cholesterol transfer proteins. Activation of StarD4 by sterol regulatory element-binding protein-2 and StarD5 by endoplasmic reticulum stress.
15583024 2004 Overview of steroidogenic enzymes in the pathway from cholesterol to active steroid hormones.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12770731 2003 START domain proteins and the intracellular trafficking of cholesterol in steroidogenic cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011452 2002 The cholesterol-regulated StarD4 gene encodes a StAR-related lipid transfer protein with two closely related homologues, StarD5 and StarD6.
11247670 2001 Identification of mesoderm development (mesd) candidate genes by comparative mapping and genome sequence analysis.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.