Property Summary

NCBI Gene PubMed Count 18
PubMed Score 7.87
PubTator Score 7.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -4.300 2.6e-09
osteosarcoma -2.439 1.8e-09
pancreatic ductal adenocarcinoma liver m... -1.185 3.7e-03

Gene RIF (8)

AA Sequence

MDPALAAQMSEAVAEKMLQYRRDTAGWKICREGNGVSVSWRPSVEFPGNLYRGEGIVYGTLEEVWDCVKP      1 - 70
AVGGLRVKWDENVTGFEIIQSITDTLCVSRTSTPSAAMKLISPRDFVDLVLVKRYEDGTISSNATHVEHP     71 - 140
LCPPKPGFVRGFNHPCGCFCEPLPGEPTKTNLVTFFHTDLSGYLPQNVVDSFFPRSMTRFYANLQKAVKQ    141 - 210
FHE                                                                       211 - 213
//

Text Mined References (20)

PMID Year Title