Property Summary

NCBI Gene PubMed Count 16
PubMed Score 14.82
PubTator Score 13.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
active Crohn's disease 1.444 5.3e-03
active ulcerative colitis 1.060 1.5e-02
adrenocortical carcinoma 1.148 4.3e-02
ependymoma -1.200 1.1e-02
group 3 medulloblastoma -1.200 1.3e-03
interstitial cystitis 1.100 2.7e-03
lung carcinoma -1.800 5.0e-19
pancreatic ductal adenocarcinoma liver m... -1.378 5.6e-03
Pick disease -1.500 7.2e-05
pituitary cancer 1.500 2.7e-04
progressive supranuclear palsy -1.400 1.6e-02
psoriasis 1.200 2.2e-29

Gene RIF (12)

AA Sequence

MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHI      1 - 70
RPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDE     71 - 140
KRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL         141 - 205
//

Text Mined References (18)

PMID Year Title