Property Summary

NCBI Gene PubMed Count 41
PubMed Score 36.80
PubTator Score 44.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count
Prostatic Neoplasms 471

Expression

 GO Function (1)

Gene RIF (22)

PMID Text
25681734 Elevated StARD3 expression may contribute to breast cancer aggressiveness by increasing membrane cholesterol and enhancing oncogenic signaling.
25459514 Data indicate that mitochondrial proteolytic activation of START domain-containing protein 3 (STARD3) enhances steroidogenesis.
24291029 Haplotype analysis indicated that combined effect of STARD3 variants (rs9972882, rs881844, rs11869286 and rs1877031) might affect the risk of GC.
24276243 Findings show that PPP1R1B-STARD3 fusion transcript has a key role in subsets of gastric cancers through the activation of PI3K/AKT signaling.
24105263 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the endoplasmic reticulum.
21322544 data indicate that StARD3 is the primary lutein-binding protein in macula lutea; recombinant StARD3 selectively binds lutein with high affinity
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20198306 FAK contributed to the increased adhesion in MDA-MB-231DeltaMLN64 cells.
19965586 a transport pathway for endosomal cholesterol to mitochondria that requires MLN64, but not NPC1
19913121 Observational study of gene-disease association. (HuGE Navigator)
19272380 Differential regulation of STARD1 and D3 reflects their distinct roles in macrophage cholesterol metabolism, and may inform anti-atherogenic strategies.
19124506 Observational study of gene-disease association. (HuGE Navigator)
18331352 provide evidence for differential cholesterol binding of the two most closely related START domain proteins STARD1 and STARD3
17117180 Observational study of gene-disease association. (HuGE Navigator)
16990645 three-dimensional atomic models of the StART domains of metastatic lymph node 64 (MLN64) and steroidogenic acute regulatory protein (StAR) proteins in complex with cholesterol
16709157 In this review, MLN64 defines discrete cholesterol-containing subdomains within the membrane of late endosomes where they may function in cholesterol transport.
15930133 local sterol enrichment by MLN64 in the late endosomal membranes facilitates their association with actin, thereby governing actin-dependent fusion and degradative activity of late endocytic organelles
15718238 The MENTAL (MLN64 amino-terminal shared with MENTHO) domain might serve to maintain cholesterol at the membrane of late endosomes prior to its shuttle to cytoplasmic acceptor(s).
15010812 Oncogenomic recombination hotspot around the PPP1R1B-STARD3-TCAP-PNMT-PERLD1-ERBB2-C17orf37-GRB7 amplicon at human chromosome 17q12 is closely linked to evolutionary recombination hotspot around the GSDML-GSDM locus.
14715710 With saturating MLN64, steroidogenesis by placental mitochondria proceeds at near-maximal rate.
12398991 NPC2, NPC1 and MLN64 may act in an ordered sequence to sense cholesterol, effect sterol movement, and consequently, influence the process of vesicular trafficking.
12070139 role of MLN64 in cholesterol transport from lysosomes to steroidogenic mitochondria

AA Sequence

MSKLPRELTRDLERSLPAVASLGSSLSHSQSLSSHLLPPPEKRRAISDVRRTFCLFVTFDLLFISLLWII      1 - 70
ELNTNTGIRKNLEQEIIQYNFKTSFFDIFVLAFFRFSGLLLGYAVLRLRHWWVIAVTTLVSSAFLIVKVI     71 - 140
LSELLSKGAFGYLLPIVSFVLAWLETWFLDFKVLPQEAEEERWYLAAQVAVARGPLLFSGALSEGQFYSP    141 - 210
PESFAGSDNESDEEVAGKKSFSAQEREYIRQGKEATAVVDQILAQEENWKFEKNNEYGDTVYTIEVPFHG    211 - 280
KTFILKTFLPCPAELVYQEVILQPERMVLWNKTVTACQILQRVEDNTLISYDVSAGAAGGVVSPRDFVNV    281 - 350
RRIERRRDRYLSSGIATSHSAKPPTHKYVRGENGPGGFIVLKSASNPRVCTFVWILNTDLKGRLPRYLIH    351 - 420
QSLAATMFEFAFHLRQRISELGARA                                                 421 - 445
//

Text Mined References (42)

PMID Year Title
25681734 2015 Elevated levels of StAR-related lipid transfer protein 3 alter cholesterol balance and adhesiveness of breast cancer cells: potential mechanisms contributing to progression of HER2-positive breast cancers.
25459514 2015 Mitochondrial proteases act on STARD3 to activate progesterone synthesis in human syncytiotrophoblast.
25416956 2014 A proteome-scale map of the human interactome network.
24291029 2014 Association analysis of ERBB2 amplicon genetic polymorphisms and STARD3 expression with risk of gastric cancer in the Chinese population.
24276243 2014 PPP1R1B-STARD3 chimeric fusion transcript in human gastric cancer promotes tumorigenesis through activation of PI3K/AKT signaling.
24105263 2013 STARD3 or STARD3NL and VAP form a novel molecular tether between late endosomes and the ER.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
21322544 2011 Identification of StARD3 as a lutein-binding protein in the macula of the primate retina.
20686565 2010 Biological, clinical and population relevance of 95 loci for blood lipids.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20198306 2010 Expression of MLN64 influences cellular matrix adhesion of breast cancer cells, the role for focal adhesion kinase.
19965586 2010 MLN64 mediates egress of cholesterol from endosomes to mitochondria in the absence of functional Niemann-Pick Type C1 protein.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19272380 2009 Differential regulation of the STARD1 subfamily of START lipid trafficking proteins in human macrophages.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
18331352 2008 Cholesterol interaction with the related steroidogenic acute regulatory lipid-transfer (START) domains of StAR (STARD1) and MLN64 (STARD3).
17897319 2007 Integral and associated lysosomal membrane proteins.
17117180 2006 HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to breast cancer.
16990645 2006 Modeling the structure of the StART domains of MLN64 and StAR proteins in complex with cholesterol.
16709157 2006 MLN64 and MENTHO, two mediators of endosomal cholesterol transport.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15930133 2005 MLN64 is involved in actin-mediated dynamics of late endocytic organelles.
15718238 2005 Functional characterization of the MENTAL domain.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15010812 2004 Evolutionary recombination hotspot around GSDML-GSDM locus is closely linked to the oncogenomic recombination hotspot around the PPP1R1B-ERBB2-GRB7 amplicon.
14715710 2004 Molten globule structure and steroidogenic activity of N-218 MLN64 in human placental mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459035 2002 Insights into steroidogenic acute regulatory protein (StAR)-dependent cholesterol transfer in mitochondria: evidence from molecular modeling and structure-based thermodynamics supporting the existence of partially unfolded states of StAR.
12398991 2002 Sterols and intracellular vesicular trafficking: lessons from the study of NPC1.
12070139 2002 MLN64 mediates mobilization of lysosomal cholesterol to steroidogenic mitochondria.
12011453 2002 Crystal structure of the Mus musculus cholesterol-regulated START protein 4 (StarD4) containing a StAR-related lipid transfer domain.
12011452 2002 The cholesterol-regulated StarD4 gene encodes a StAR-related lipid transfer protein with two closely related homologues, StarD5 and StarD6.
11196440 2000 Evidence that StAR and MLN64 act on the outer mitochondrial membrane as molten globules.
11053434 2001 The steroidogenic acute regulatory protein homolog MLN64, a late endosomal cholesterol-binding protein.
10995240 2000 N-218 MLN64, a protein with StAR-like steroidogenic activity, is folded and cleaved similarly to StAR.
10802740 2000 Structure and lipid transport mechanism of a StAR-related domain.
9270027 1997 Isolation of a candidate gene, CAB1, for cholesterol transport to mitochondria from the c-ERBB-2 amplicon by a modified cDNA selection method.
9237999 1997 MLN64 contains a domain with homology to the steroidogenic acute regulatory protein (StAR) that stimulates steroidogenesis.
9139840 1997 MLN64 exhibits homology with the steroidogenic acute regulatory protein (STAR) and is over-expressed in human breast carcinomas.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7490069 1995 Identification of four novel human genes amplified and overexpressed in breast carcinoma and localized to the q11-q21.3 region of chromosome 17.