Property Summary

NCBI Gene PubMed Count 45
PubMed Score 75.37
PubTator Score 25.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (11)

Disease log2 FC p
lung cancer -2.200 8.0e-05
colon cancer -1.600 8.8e-03
ductal carcinoma in situ -1.200 2.7e-03
group 4 medulloblastoma 1.200 5.9e-03
Hydrolethalus syndrome 1.216 6.2e-03
intraductal papillary-mucinous neoplasm ... -1.300 6.2e-03
invasive ductal carcinoma -1.500 8.0e-04
lung adenocarcinoma -1.300 1.7e-18
lung carcinoma -1.100 1.8e-09
non-small cell lung cancer -2.049 3.2e-28
psoriasis -2.700 4.0e-05

 IMPC Phenotype (1)

Protein-protein Interaction (2)

Gene RIF (18)

AA Sequence

MFSQVPRTPASGCYYLNSMTPEGQEMYLRFDQTTRRSPYRMSRILARHQLVTKIQQEIEAKEACDWLRAA      1 - 70
GFPQYAQLYEDSQFPINIVAVKNDHDFLEKDLVEPLCRRLNTLNKCASMKLDVNFQRKKGDDSDEEDLCI     71 - 140
SNKWTFQRTSRRWSRVDDLYTLLPRGDRNGSPGGTGMRNTTSSESVLTDLSEPEVCSIHSESSGGSDSRS    141 - 210
QPGQCCTDNPVMLDAPLVSSSLPQPPRDVLNHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGR    211 - 280
TGGLVISGPMLQQEPESFKAMQCIQIPNGDLQNSPPPACRKGLPCSGKSSGESSPSEHSSSGVSTPCLKE    281 - 350
RKCHEANKRGGMYLEDLDVLAGTALPDAGDQSRMHEFHSQENLVVHIPKDHKPGTFPKALSIESLSPTDS    351 - 420
SNGVNWRTGSISLGREQVPGAREPRLMASCHRASRVSIYDNVPGSHLYASTGDLLDLEKDDLFPHLDDIL    421 - 490
QHVNGLQEVVDDWSKDVLPELQTHDTLVGEPGLSTFPSPNQITLDFEGNSVSEGRTTPSDVERDVTSLNE    491 - 560
SEPPGVRDRRDSGVGASLTRPNRRLRWNSFQLSHQPRPAPASPHISSQTASQLSLLQRFSLLRLTAIMEK    561 - 630
HSMSNKHGWTWSVPKFMKRMKVPDYKDKAVFGVPLIVHVQRTGQPLPQSIQQALRYLRSNCLDQVGLFRK    631 - 700
SGVKSRIHALRQMNENFPENVNYEDQSAYDVADMVKQFFRDLPEPLFTNKLSETFLHIYQYVSKEQRLQA    701 - 770
VQAAILLLADENREVLQTLLCFLNDVVNLVEENQMTPMNLAVCLAPSLFHLNLLKKESSPRVIQKKYATG    771 - 840
KPDQKDLNENLAAAQGLAHMIMECDRLFEVPHELVAQSRNSYVEAEIHVPTLEELGTQLEESGATFHTYL    841 - 910
NHLIQGLQKEAKEKFKGWVTCSSTDNTDLAFKKVGDGNPLKLWKASVEVEAPPSVVLNRVLRERHLWDED    911 - 980
FVQWKVVETLDRQTEIYQYVLNSMAPHPSRDFVVLRTWKTDLPKGMCTLVSLSVEHEEAQLLGGVRAVVM    981 - 1050
DSQYLIEPCGSGKSRLTHICRIDLKGHSPEWYSKGFGHLCAAEVARIRNSFQPLIAEGPETKI          1051 - 1113
//

Text Mined References (47)

PMID Year Title