Property Summary

NCBI Gene PubMed Count 21
PubMed Score 135.49
PubTator Score 9.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma -2.700 1.2e-06
non-small cell lung cancer 1.159 9.8e-13
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
intraductal papillary-mucinous neoplasm ... 1.400 3.5e-03
lung cancer 1.300 1.8e-03
fibroadenoma 1.200 3.2e-02
interstitial cystitis -1.900 1.2e-03
group 3 medulloblastoma 1.200 1.2e-02
lung adenocarcinoma 1.200 6.1e-09
spina bifida -1.810 2.3e-02
ductal carcinoma in situ 1.400 1.6e-03
ulcerative colitis -1.700 1.5e-05

Gene RIF (12)

PMID Text
23700042 STAP2 is upregulated in uterosacral ligaments in pelvic organ prolapse
22611243 STAP-2 is a novel participant in the regulation of T cell apoptosis after stimulation
22231445 Our results demonstrate a critical contribution of STAP-2 in BCR-ABL activity.
20929863 Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
19933863 STAP-2 expression in Jurkat T cells affects migration following stromal cell-derived factor-1alpha (SDF-1alpha) treatment; STAP-2 association with Vav1, the guanine-nucleotide exchanging factor for Rac1, enhances downstream Vav1/Rac1 signaling.
19401194 These results indicate that Cbl regulates STAP-2 protein levels and Brk/STAP-2-mediated STAT3 activation.
19393627 STAP-2 is phosphorylated at Tyr250 by Brk, and plays an important role in Brk-mediated STAT3 activation.
18573890 These results suggest that STAP-2 acts as an endogenous negative regulator of Epstein-Barr virus LMP1-mediated signaling through TRAF3 and TRADD.
17675501 STAP-2 associates with FAK and enhances its degradation, proteasome inhibitors block FAK degradation, and STAP-2 recruits an endogenous E3 ubiquitin ligase, Cbl, to FAK.
15611091 STAP-2/BKS is a modulator of STAT5-mediated signaling
12810085 These data indicate that STAP-2/BKS negatively controls the FcepsilonRI-mediated calcium mobilization and degranulation by direct modulation of tyrosine phosphorylation of PLC-gamma.

AA Sequence

MASALRPPRVPKPKGVLPSHYYESFLEKKGPCDRDYKKFWAGLQGLTIYFYNSNRDFQHVEKLNLGAFEK      1 - 70
LTDEIPWGSSRDPGTHFSLILRDQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLA     71 - 140
KEEARRALETPSCFLKVSRLEAQLLLERYPECGNLLLRPSGDGADGVSVTTRQMHNGTHVVRHYKVKREG    141 - 210
PKYVIDVEQPFSCTSLDAVVNYFVSHTKKALVPFLLDEDYEKVLGYVEADKENGENVWVAPSAPGPGPAP    211 - 280
CTGGPKPLSPASSQDKLPPLPPLPNQEENYVTPIGDGPAVDYENQDVASSSWPVILKPKKLPKPPAKLPK    281 - 350
PPVGPKPEPKVFNGGLGRKLPVSSAQPLFPTAGLADMTAELQKKLEKRRALEH                     351 - 403
//

Text Mined References (22)

PMID Year Title
23700042 2013 Estrogen-related genome-based expression profiling study of uterosacral ligaments in women with pelvic organ prolapse.
22611243 2012 Signal-transducing adaptor protein-2 modulates Fas-mediated T cell apoptosis by interacting with caspase-8.
22231445 2012 STAP-2 interacts with and modulates BCR-ABL-mediated tumorigenesis.
20929863 2010 Interactions of STAP-2 with Brk and STAT3 participate in cell growth of human breast cancer cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19933863 2009 Signal-transducing adaptor protein-2 regulates stromal cell-derived factor-1 alpha-induced chemotaxis in T cells.
19401194 2009 The protein content of an adaptor protein, STAP-2 is controlled by E3 ubiquitin ligase Cbl.
19393627 2009 STAP-2 is phosphorylated at tyrosine-250 by Brk and modulates Brk-mediated STAT3 activation.
18573890 2008 STAP-2 negatively regulates both canonical and noncanonical NF-kappaB activation induced by Epstein-Barr virus-derived latent membrane protein 1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17675501 2007 Signal-transducing adaptor protein-2 regulates integrin-mediated T cell adhesion through protein degradation of focal adhesion kinase.
16365431 2006 Modulation of TLR4 signaling by a novel adaptor protein signal-transducing adaptor protein-2 in macrophages.
15611091 2005 Physical and functional interactions between STAP-2/BKS and STAT5.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810085 2003 Regulation of FcepsilonRI-mediated signaling by an adaptor protein STAP-2/BSK in rat basophilic leukemia RBL-2H3 cells.
12540842 2003 STAP-2/BKS, an adaptor/docking protein, modulates STAT3 activation in acute-phase response through its YXXQ motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11441184 2001 Human chromosome 19 and related regions in mouse: conservative and lineage-specific evolution.
10980601 2000 A novel adaptor-like protein which is a substrate for the non-receptor tyrosine kinase, BRK.
7644468 1995 Cloning and characterization of a human type II receptor for bone morphogenetic proteins.