Property Summary

NCBI Gene PubMed Count 23
PubMed Score 3.43
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
cutaneous lupus erythematosus 3.500 1.3e-04
interstitial cystitis 2.100 3.7e-03
medulloblastoma, large-cell 1.300 1.2e-02
nasopharyngeal carcinoma -1.300 2.5e-02
osteosarcoma -2.822 2.3e-10
periodontitis 1.300 1.7e-22
pituitary cancer 1.100 8.8e-03
primary Sjogren syndrome 1.400 5.6e-04
ulcerative colitis 1.100 4.3e-02
Waldenstrons macroglobulinemia 1.476 1.9e-02

Gene RIF (3)

AA Sequence

MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLD      1 - 70
IVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHE     71 - 140
VLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRN    141 - 210
YSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPS    211 - 280
MEGRSEKLKKNPHIA                                                           281 - 295
//

Text Mined References (25)

PMID Year Title