Property Summary

NCBI Gene PubMed Count 22
PubMed Score 3.27
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.476 1.9e-02
cutaneous lupus erythematosus 3.500 1.3e-04
osteosarcoma -4.380 1.4e-08
periodontitis 1.300 1.7e-22
medulloblastoma, large-cell 1.300 1.2e-02
interstitial cystitis 3.000 3.7e-03
primary Sjogren syndrome 2.700 1.2e-04
nasopharyngeal carcinoma -1.300 2.5e-02
ulcerative colitis 2.000 1.5e-02
pituitary cancer 1.100 8.8e-03

Synonym

Accession Q9ULZ2 B2R980 STAP-1
Symbols BRDG1
STAP-1

Gene

PANTHER Protein Class (2)

PDB

1X1F   3MAZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

PMID Text
25035151 Mutations in STAP1 are associated with autosomal dominant hypercholesterolemia.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MMAKKPPKPAPRRIFQERLKITALPLYFEGFLLIKRSGYREYEHYWTELRGTTLFFYTDKKSIIYVDKLD      1 - 70
IVDLTCLTEQNSTEKNCAKFTLVLPKEEVQLKTENTESGEEWRGFILTVTELSVPQNVSLLPGQVIKLHE     71 - 140
VLEREKKRRIETEQSTSVEKEKEPTEDYVDVLNPMPACFYTVSRKEATEMLQKNPSLGNMILRPGSDSRN    141 - 210
YSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPS    211 - 280
MEGRSEKLKKNPHIA                                                           281 - 295
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25035151 2014 Mutations in STAP1 are associated with autosomal dominant hypercholesterolemia.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
20442417 2010 Loops govern SH2 domain specificity by controlling access to binding pockets.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18468998 2008 Blood pressure is regulated by an alpha1D-adrenergic receptor/dystrophin signalosome.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17936702 2007 S6K1-mediated disassembly of mitochondrial URI/PP1gamma complexes activates a negative feedback program that counters S6K1 survival signaling.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17052657 2006 Genome-wide genotyping in Parkinson's disease and neurologically normal controls: first stage analysis and public release of data.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15090612 2004 CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12540842 2003 STAP-2/BKS, an adaptor/docking protein, modulates STAT3 activation in acute-phase response through its YXXQ motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11716489 2001 Isoform-dependent interaction of BRDG1 with Tec kinase.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
10679268 2000 Molecular cloning of murine STAP-1, the stem-cell-specific adaptor protein containing PH and SH2 domains.
10518561 1999 Molecular cloning of a docking protein, BRDG1, that acts downstream of the Tec tyrosine kinase.
10358768 1999 Genetic analysis of B cell antigen receptor signaling.