Property Summary

NCBI Gene PubMed Count 18
PubMed Score 3.76
PubTator Score 4.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.900 7.2e-03
oligodendroglioma -1.400 4.5e-02
glioblastoma -1.700 9.3e-05
osteosarcoma -2.448 7.3e-05
chronic lymphosyte leukemia 1.400 6.8e-04
medulloblastoma -2.200 1.8e-04
atypical teratoid / rhabdoid tumor -2.900 4.9e-07
medulloblastoma, large-cell -1.700 3.6e-03
primitive neuroectodermal tumor -1.700 1.1e-02
primary pancreatic ductal adenocarcinoma 1.465 1.0e-02
intraductal papillary-mucinous carcinoma... 1.500 6.0e-04
cystic fibrosis 1.100 5.6e-03
primary Sjogren syndrome 2.000 3.0e-04
Pick disease -1.100 7.2e-03
acute myeloid leukemia -1.500 2.7e-02
ovarian cancer -3.200 4.6e-10
pituitary cancer 1.300 2.1e-05
pancreatic cancer 1.600 5.1e-03

Gene RIF (6)

PMID Text
26256234 Catalytic Mechanism of Human AMSH-LP Domain Deubiquitinating Enzymes
22258247 Cellular STAMBPL1 is a positive regulator of human T-cell leukemia virus type 1 Tax-mediated NF-kappaB signaling.
17426287 AMSH redirects CaR from slow recycling to down-regulation, reducing CaR expression and decreasing PTHrP secretion.
16716190 AMSH and AMSH-LP are anchored on the early endosomal membrane via interaction with the clathrin coat
16385451 Observational study of gene-disease association. (HuGE Navigator)
12810066 Data show that associated molecule with the SH3 domain of STAM-like protein (AMSH-LP), unlike AMSH, fails to bind to the SH3 domains of STAM1 (signal transducing adaptor molecule 1) and Grb2.

AA Sequence

MDQPFTVNSLKKLAAMPDHTDVSLSPEERVRALSKLGCNITISEDITPRRYFRSGVEMERMASVYLEEGN      1 - 70
LENAFVLYNKFITLFVEKLPNHRDYQQCAVPEKQDIMKKLKEIAFPRTDELKNDLLKKYNVEYQEYLQSK     71 - 140
NKYKAEILKKLEHQRLIEAERKRIAQMRQQQLESEQFLFFEDQLKKQELARGQMRSQQTSGLSEQIDGSA    141 - 210
LSCFSTHQNNSLLNVFADQPNKSDATNYASHSPPVNRALTPAATLSAVQNLVVEGLRCVVLPEDLCHKFL    211 - 280
QLAESNTVRGIETCGILCGKLTHNEFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLGWIHTHP    281 - 350
TQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHKDTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSIC    351 - 420
KHVLVKDIKIIVLDLR                                                          421 - 436
//

Text Mined References (22)

PMID Year Title
26256234 2015 Quantum Mechanics and Molecular Mechanics Study of the Catalytic Mechanism of Human AMSH-LP Domain Deubiquitinating Enzymes.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22258247 2012 An RNA interference screen identifies the Deubiquitinase STAMBPL1 as a critical regulator of human T-cell leukemia virus type 1 tax nuclear export and NF-?B activation.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21163940 2011 Interactome mapping suggests new mechanistic details underlying Alzheimer's disease.
19946888 2010 Defining the membrane proteome of NK cells.
18758443 2008 Structural basis for specific cleavage of Lys 63-linked polyubiquitin chains.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17426287 2007 Calcium-sensing receptor endocytosis links extracellular calcium signaling to parathyroid hormone-related peptide secretion via a Rab11a-dependent and AMSH-sensitive mechanism.
16716190 2006 Clathrin anchors deubiquitinating enzymes, AMSH and AMSH-like protein, on early endosomes.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14728725 2004 Cloning of a novel signaling molecule, AMSH-2, that potentiates transforming growth factor beta signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12943674 2003 A newly identified AMSH-family protein is specifically expressed in haploid stages of testicular germ cells.
12810066 2003 Identification of AMSH-LP containing a Jab1/MPN domain metalloenzyme motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10718198 2000 Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro.