Property Summary

NCBI Gene PubMed Count 39
PubMed Score 12.62
PubTator Score 60.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
chronic lymphocytic leukemia 1.658 1.6e-04
Multiple myeloma 1.411 2.6e-03
psoriasis 1.600 5.1e-04
juvenile dermatomyositis 1.286 4.7e-11
acute quadriplegic myopathy 1.788 5.1e-06
ovarian cancer -1.700 1.6e-06

 GO Function (1)

Gene RIF (13)

PMID Text
26601948 The VHS domain of STAM1 directs AMSH to cleave longer Lys63-linked ubiquitin chains
25884766 Differential expression of the transcripts STAM connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
25296754 ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation.
22275353 Overexpression of an AIP4 catalytically inactive mutant and a mutant that shows poor binding to STAM-1 fails to enhance CXCR4-induced ERK-1/2 signaling.
19111546 A novel ubiquitin binding site and the manner of ubiquitin recognition of the STAM1 VHS domain were proposed.
19054391 STAMs function prominently in endoplasmic reticulum-to-Golgi trafficking, most likely through direct interactions with the coat protein II complex
16520378 The cellular functions of UBPY are complex but clearly distinct from those of the Lys-63-ubiquitin-specific protease, AMSH, with which it shares a binding site on the SH3 domain of STAM
16385451 Observational study of gene-disease association. (HuGE Navigator)
15828871 Analysis with phospho-specific antibodies indicates that 3 kinases generate a signal-specific, combinatorial phosphorylation profile of the Hrs-STAM complex, with the potential of diversifying tyrosine kinase receptor signalling through a common element.
15640163 Hrs is a master molecule that controls in part the degradation of STAM1 and the accumulation of ubiquitinated proteins
15113837 Data suggested that association with hepatocyte growth factor-regulated tyrosine kinase substrate is a prerequisite for STAM1 function in early endosome.
12745081 Interaction of TIMM8a with STAM1.
12551915 STAM proteins function in a multivalent complex that sorts ubiquitinated proteins into the multivesicular body pathway.

AA Sequence

MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG      1 - 70
ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV     71 - 140
TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH    141 - 210
EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK    211 - 280
TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI    281 - 350
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA    351 - 420
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA    421 - 490
ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL                        491 - 540
//

Text Mined References (46)

PMID Year Title
26601948 2016 The Vps27/Hrs/STAM (VHS) Domain of the Signal-transducing Adaptor Molecule (STAM) Directs Associated Molecule with the SH3 Domain of STAM (AMSH) Specificity to Longer Ubiquitin Chains and Dictates the Position of Cleavage.
25884766 2015 Epigenetic regulation of lncRNA connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
25296754 2014 ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105262 2013 Analysis of ESCRT functions in exosome biogenesis, composition and secretion highlights the heterogeneity of extracellular vesicles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22275353 2012 Novel roles for the E3 ubiquitin ligase atrophin-interacting protein 4 and signal transduction adaptor molecule 1 in G protein-coupled receptor signaling.
21269460 2011 Initial characterization of the human central proteome.
21187078 2011 Solution structure of UIM and interaction of tandem ubiquitin binding domains in STAM1 with ubiquitin.
20927613 2011 Backbone 1H, 13C, and 15N assignments for the tandem ubiquitin binding domains of signal transducing adapter molecule 1.
20588296 2010 Membrane budding and scission by the ESCRT machinery: it's all in the neck.
20505072 2010 Arrestin-2 interacts with the endosomal sorting complex required for transport machinery to modulate endosomal sorting of CXCR4.
20494825 2010 Mutation of tyrosine residue 857 in the PDGF beta-receptor affects cell proliferation but not migration.
20150893 2010 VHS domains of ESCRT-0 cooperate in high-avidity binding to polyubiquitinated cargo.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19278655 2009 Hybrid structural model of the complete human ESCRT-0 complex.
19111546 2009 Identification of a novel ubiquitin binding site of STAM1 VHS domain by NMR spectroscopy.
19054391 2009 STAM adaptor proteins interact with COPII complexes and function in ER-to-Golgi trafficking.
17235283 2007 Efficient T-cell receptor signaling requires a high-affinity interaction between the Gads C-SH3 domain and the SLP-76 RxxK motif.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17078930 2006 STAM-AMSH interaction facilitates the deubiquitination activity in the C-terminal AMSH.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16730941 2006 A systematic analysis of human CHMP protein interactions: additional MIT domain-containing proteins bind to multiple components of the human ESCRT III complex.
16520378 2006 The ubiquitin isopeptidase UBPY regulates endosomal ubiquitin dynamics and is essential for receptor down-regulation.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15951569 2005 Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules.
15828871 2005 Growth factors induce differential phosphorylation profiles of the Hrs-STAM complex: a common node in signalling networks with signal-specific properties.
15640163 2005 Hrs, a mammalian master molecule in vesicular transport and protein sorting, suppresses the degradation of ESCRT proteins signal transducing adaptor molecule 1 and 2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15113837 2004 Association with Hrs is required for the early endosomal localization, stability, and function of STAM.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12972556 2003 STAM proteins bind ubiquitinated proteins on the early endosome via the VHS domain and ubiquitin-interacting motif.
12750381 2003 Structure and ubiquitin binding of the ubiquitin-interacting motif.
12745081 2003 Interaction of the deafness-dystonia protein DDP/TIMM8a with the signal transduction adaptor molecule STAM1.
12551915 2003 STAM and Hrs are subunits of a multivalent ubiquitin-binding complex on early endosomes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11687594 2002 Tyrosine phosphorylation mapping of the epidermal growth factor receptor signaling pathway.
11031247 2000 Secretory protein trafficking and organelle dynamics in living cells.
10899310 2000 STAM2, a new member of the STAM family, binding to the Janus kinases.
10383417 1999 Possible involvement of a novel STAM-associated molecule "AMSH" in intracellular signal transduction mediated by cytokines.
9407053 1997 Hrs is associated with STAM, a signal-transducing adaptor molecule. Its suppressive effect on cytokine-induced cell growth.
9133424 1997 STAM, signal transducing adaptor molecule, is associated with Janus kinases and involved in signaling for cell growth and c-myc induction.
8780729 1996 Cloning of a novel signal-transducing adaptor molecule containing an SH3 domain and ITAM.